SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334711|ref|YP_005888658.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334711|ref|YP_005888658.1|
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 2.62e-27
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334711|ref|YP_005888658.1|
Sequence length 142
Comment PTS system mannitol-specific component IIA [Mycoplasma hyopneumoniae 168]
Sequence
MNLKLENIHLNQIITSKKQAFEKLIRIFQQKNCCEFEYLQSMEKRDLESSVALGNFLALP
HGNFEGNNLIFRNCIEIVHLKNTLNWDGQPVKFVIGLAVKDSEQIDYIQKIGLAFIDVEK
VEEILNDSDLSKQKILDWIINN
Download sequence
Identical sequences A0A223MB78 E4QTK9 Q4A9D3 Q5ZZZ0
gi|71893903|ref|YP_279349.1| gi|385334711|ref|YP_005888658.1| WP_011206399.1.100269 WP_011206399.1.25027 WP_011206399.1.28423 WP_011206399.1.29754 WP_011206399.1.51147 WP_011206399.1.62369 WP_011206399.1.76180 262719.MHJ_0552 295358.mhp567 gi|507382972|ref|YP_008025974.1| gi|54020586|ref|YP_116075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]