SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334713|ref|YP_005888660.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334713|ref|YP_005888660.1|
Domain Number 1 Region: 392-484
Classification Level Classification E-value
Superfamily PTS system IIB component-like 1.7e-21
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.0015
Further Details:      
 
Weak hits

Sequence:  gi|385334713|ref|YP_005888660.1|
Domain Number - Region: 114-172
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0902
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334713|ref|YP_005888660.1|
Sequence length 491
Comment Pts system, mannitol-specific IIbc component [Mycoplasma hyopneumoniae 168]
Sequence
MANLFKMLKTKIQAFGSLLGQMIMPIIGIFIAWGLLTSFFIPAGWTPNKELATMVKIGIV
YIIPILICFLGGYKIYKMRGGAIAGIVAIASVAAGQSETFSQITGGTAPMLVSVMLFGPV
SALILKHSEKFWIHKIPSGYQMLVNNFYLGILGFVLLFPVYYLSIYFIGYFIKSLGILTA
KMGQWKLYPLIALIVEPAKILFLNNAINHGVFTTLGAIQVTETGKSILFLLESNPGPGLG
LLLFYLIFSKEKIIKGQATSSIPIHFLGGIHEVYFPFALLRPILILALIAGGVFANAIFQ
IFNVGAVAPVSPGSIIAQYLQVEKSTNSLVGLTIGIFGSAAATLVAAWGVNFLAKLINRK
KTKKETFALESAKKLVESEKIKLKKPTENNLNWKQIVFACDAGMGSSVMAASIFRKILKE
NGIRNVEITNLAIADLTGAEEIIITIQSLEDRVKAKNSTAKIITLTQFLDKKSYENLAKK
IKKIQEKEGFL
Download sequence
Identical sequences E4QTL1
WP_014579953.1.28423 WP_014579953.1.62369 gi|507382974|ref|YP_008025976.1| gi|385334713|ref|YP_005888660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]