SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334716|ref|YP_005888663.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334716|ref|YP_005888663.1|
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily PTS system IIB component-like 1.57e-16
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334716|ref|YP_005888663.1|
Sequence length 91
Comment PTS system galactitol-specific enzyme IIB component [Mycoplasma hyopneumoniae 168]
Sequence
MKIKCVCGSGLGSSLLLELNVKSVLEKLKINYDSVEHTNISSFNSRGVDLVVIGADVAPS
LDFDKSKMVILTNILSKEELEIKLKKTLKIT
Download sequence
Identical sequences A0A223MBI8 E4QTL4
gi|385334716|ref|YP_005888663.1| WP_014579955.1.25027 WP_014579955.1.28423 WP_014579955.1.29754 WP_014579955.1.62369 gi|507382977|ref|YP_008025979.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]