SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334717|ref|YP_005888664.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334717|ref|YP_005888664.1|
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 1.83e-23
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334717|ref|YP_005888664.1|
Sequence length 151
Comment PTS system enzyme IIA component [Mycoplasma hyopneumoniae 168]
Sequence
MELFNEKMTKFCKIKNWNQAVHEGVRILVENKKATYDLEKAIMEQTAKYGAYYVLEEGVA
LLHAPVGDYCLEVGTSILVLDEMITFNNQKNKKAKIIITLSAPNSNDHIALIQEFGLFFG
NSDFKKEIYASRTIKEFYQIIKKYKGLKNEN
Download sequence
Identical sequences E4QTL5 Q4A7G9 Q4A9C7 Q5ZZY4
295358.mhp573 gi|507382978|ref|YP_008025980.1| WP_011206405.1.100269 WP_011206405.1.28423 WP_011206405.1.29754 WP_011206405.1.4867 WP_011206405.1.51147 WP_011206405.1.62369 WP_011206405.1.76180 gi|54020591|ref|YP_116081.1| gi|385334717|ref|YP_005888664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]