SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334731|ref|YP_005888678.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334731|ref|YP_005888678.1|
Domain Number 1 Region: 516-591
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.000000000000101
Family Glucose permease domain IIB 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334731|ref|YP_005888678.1|
Sequence length 593
Comment PTS system, N-acetylglucosamine-specific II ABC component [Mycoplasma hyopneumoniae 168]
Sequence
MSVRLVKKIKFFQPKKAENYSQNSIFNRILNQLQRLGRSLMFPIAVLPIAALLLRIGALI
QDPLANGSIGISETQKFWGRLISTPGGIVFDNLAIIFAIGIGFGFAKDNRGEAALVAAVV
WYGMSTLLKQNQLAETIYKNVLVAKSGQLKGFTQLLYFLKAGKPVYQLDSGVIGGISVGL
VVAFLYNKYKNIKLPQTLSFFGGRRFVPMLGILSIIPLGLIFAIIWPWAQYGLIKIGSAL
SDQSANHYARGFYVSIYAFLNRLLQPFGLHHILNTFVWFQLPIKGKLISPVINQVGETVA
KLGEIYTVNGDITAFNTGIIGSGGFTTGFFPLYLGGLPGAAVAMIFAAKKERRKTITTFL
AGATLVGFLTGIDEPLIFTFIFISPLLWLLNAFLTSLIYMFVSWTGMSIGIGFSAGFIDY
IVSFPRSWAFAKNFGVLANPLWIWAFSAIMFVIQGSSFFFCIKKFNIKTLGREDKIEPEF
SIIDEKTDLENQQKFLPDQEKITKNKVKFADDYQKMAADFIEILGKENIEEVSNCATRLR
LILKDNAKNDELDAKITAAGGRGVVRVGNKGYQIIIGTDVEFVADYLKKMTGK
Download sequence
Identical sequences E4QTM9
gi|507382990|ref|YP_008025992.1| WP_014579965.1.28423 WP_014579965.1.29754 WP_014579965.1.62369 gi|385334731|ref|YP_005888678.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]