SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334737|ref|YP_005888684.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334737|ref|YP_005888684.1|
Domain Number 1 Region: 9-213
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.57e-22
Family Choline kinase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334737|ref|YP_005888684.1|
Sequence length 223
Comment hypothetical protein MHP168_588 [Mycoplasma hyopneumoniae 168]
Sequence
MNWKKTINFDVFPKNIREKLTNYQLISCGYHNCSFLGFFKNHKVQIRIAINNFVNWKNEE
NFIRNNPNFFFYTKGNFIKKWIEGEILSPKNLETNLQKLFFAVLEFHMQKNEKIAKFDWN
VSEIIDKKYIKLVQKYQFDQLVISHNDLQFKNIITSDKHVFLLDFEWVRLNNPYFDYVCL
YINLGISPEKIIEFFNLETEKFNDFVYLVNVFTNFWNKKFYNK
Download sequence
Identical sequences E4QTN5 Q4A7E7 Q5ZZW1 S5G0V4
262722.MHP7448_0579 295358.mhp596 WP_011206427.1.100269 WP_011206427.1.28423 WP_011206427.1.29754 WP_011206427.1.35737 WP_011206427.1.4867 WP_011206427.1.51147 WP_011206427.1.62369 gi|507382996|ref|YP_008025998.1| gi|525903742|ref|YP_008291985.1| gi|72080907|ref|YP_287965.1| gi|54020609|ref|YP_116104.1| gi|385334737|ref|YP_005888684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]