SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334747|ref|YP_005888694.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334747|ref|YP_005888694.1|
Domain Number 1 Region: 8-231,328-371
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.29e-30
Family FAD-linked reductases, N-terminal domain 0.008
Further Details:      
 
Domain Number 2 Region: 235-324
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000484
Family D-aminoacid oxidase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334747|ref|YP_005888694.1|
Sequence length 387
Comment glycerol-3-phosphate dehydrogenase [Mycoplasma hyopneumoniae 168]
Sequence
MTEKNNINYDVIIIGSGIIGTNIAYELSKFELKIALLEAKKYPASETTTGNSGIIHCGFD
PSPGKLKAKFNVLGHKLWTENIFKKIIFPRQKAKSVVLAFDSEEEKIIYDLYKRGIINGL
DPKNLSILSKKELKLAHPDVSEEAVLALECLNSWLVDPVKAAYAFLEISRKNGLEFFSSS
KVISISKNSQNFFLIKTENQNNPFFQSKIIINAAGHYADEIGKIAGFGEFSQKQRRGQYL
ILKNHPNIKNIYFLVPSKYGKGVIVAPRPDGNILVGPTAKENIPKNKVNCLDFNLNEEIQ
KIGHKIIPSLDYSETVFALAGSRPIEADKGDFVIKPAFNDPNFIFAAGMQSPGLSASPAI
ALEIVNFVKNRIDLVKKTELVEAIEYI
Download sequence
Identical sequences E4QTP5
WP_014579974.1.28423 gi|385334747|ref|YP_005888694.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]