SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334749|ref|YP_005888696.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334749|ref|YP_005888696.1|
Domain Number 1 Region: 181-470
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.4e-79
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000106
Further Details:      
 
Domain Number 2 Region: 7-178
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.96e-45
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000148
Further Details:      
 
Domain Number 3 Region: 475-575
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.78e-26
Family Anticodon-binding domain of Class II aaRS 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334749|ref|YP_005888696.1|
Sequence length 579
Comment Threonyl-tRNA synthetase [Mycoplasma hyopneumoniae 168]
Sequence
MDLKIDYKLNHSSSHLLALAIKILYPGVKFGIGPVFDDGFYYDFDLSVSISQSDFPKIEK
LMKKLVSKNLKIVETDGKNLDFQNQIYKAELKSDLEKKGEKVTYFSIVDSKNNILFEDLC
YGNHLESLGKIQNFKLLKIAGAYWKGDSKNKQLTRIYGTSWDSKENLDKFLGILQERQER
DHRKIGAKLKLFTFSSYFGHGFPVWLENGMRIYNKIRQKILEFDRNYGFKEVLTPHFGHK
ELYKISGHLLHYRDDMFKGLKIENEELIPRPMTCPHHIILFSQQLFSYRNLPYRISEQSR
LYRYEKSGALLGLERVRAMDLTEGHIFVSKSQIFSEISHLFQMISEVLDFFKVQIFYISF
SKRDPKNKDKFFQDDQMWDQAEADLKQFLEQNKINYIEKIGEAAFYGPKIDFQVKTALNK
ELTISTLQLDFLLPEKFKISFINEHNKKETPILIHRGLIGTYERFIALLLEQSKGNLPFW
ISPKQIIVIPVAEKHNDFAQKIHKILFDLGFNSEIDLRSERISRKIREANLEKINFQVII
GDEEITKNEITYRKFGSPELFRISLVDFVDLLKSSEKNV
Download sequence
Identical sequences E4QTP7
WP_014579976.1.28423 WP_014579976.1.29754 WP_014579976.1.62369 gi|507383008|ref|YP_008026010.1| gi|385334749|ref|YP_005888696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]