SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334751|ref|YP_005888698.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334751|ref|YP_005888698.1|
Domain Number 1 Region: 46-116
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.0000000000235
Family Glucose permease domain IIB 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334751|ref|YP_005888698.1|
Sequence length 118
Comment PTS system glucose-specific enzyme IIB component [Mycoplasma hyopneumoniae 168]
Sequence
MKLVSKIIYFFLQIFTFGLFAKYLKKKHNKKNSDFTYEQNFDFKIEVLINLLGGRGNIAK
SDFNISRIIIKLRSTENLDFEKIKKLKGISGIFVSSDTITLIVGNKSKAISEAINNFG
Download sequence
Identical sequences E4QTP9 Q5ZZU7
gi|54020257|ref|YP_116118.1| 295358.mhp610 WP_011206441.1.100269 WP_011206441.1.28423 WP_011206441.1.29754 WP_011206441.1.51147 WP_011206441.1.62369 gi|507383010|ref|YP_008026012.1| gi|385334751|ref|YP_005888698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]