SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334753|ref|YP_005888700.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334753|ref|YP_005888700.1|
Domain Number 1 Region: 14-241
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.28e-35
Family Ribonuclease H 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334753|ref|YP_005888700.1|
Sequence length 248
Comment ribonuclease HII [Mycoplasma hyopneumoniae 168]
Sequence
MILSKNQLYALDDLVIGCDEVGVGEYFTNLTVCCAVFREKEIKNELLIQIVDSKLLTEKK
ISDLFQVINIDQKIKHKFTSLEMNEYNKLIEDGLNSHQIKSLLYFRVLNDLILNLENEKI
NKIFIDGFVSEKKFKEYFAKIAEFLKIEPWDFQKFPLILEKKADTKIKQVGAASIIAKFA
LSQKFAKRQEKWKAVFPAGSNQIEKIVNFCVGQIEKYGKIFLEENVKLHFSITEKIYAKL
EEKNGKNN
Download sequence
Identical sequences A0A223M8T2 E4QTQ1 Q4A7D3 Q4A994
WP_014579979.1.25027 WP_014579979.1.28423 WP_014579979.1.29754 WP_014579979.1.4867 WP_014579979.1.62369 WP_014579979.1.76180 gi|385334753|ref|YP_005888700.1| gi|507383012|ref|YP_008026014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]