SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334768|ref|YP_005888715.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334768|ref|YP_005888715.1|
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily HPr-like 2.49e-24
Family HPr-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334768|ref|YP_005888715.1|
Sequence length 89
Comment phosphocarrier protein HPr [Mycoplasma hyopneumoniae 168]
Sequence
MVSFSAVVIDKLGFHARPASKVAKLASEFKSEVKIFNGEKSGNAKSIMNIMALGIKSGTE
FRIEITGEDENEAVKAIKNLIIEEKLILE
Download sequence
Identical sequences A0A223M8U6 E4QTR6 Q4A7B7 Q4A976 Q5ZZS9 S5G7H3
gi|507383027|ref|YP_008026029.1| gi|71893960|ref|YP_279406.1| 262719.MHJ_0611 262722.MHP7448_0609 295358.mhp628 WP_011206459.1.100269 WP_011206459.1.25027 WP_011206459.1.28423 WP_011206459.1.29754 WP_011206459.1.35737 WP_011206459.1.4867 WP_011206459.1.51147 WP_011206459.1.62369 WP_011206459.1.76180 gi|385334768|ref|YP_005888715.1| gi|72080937|ref|YP_287995.1| gi|54020274|ref|YP_116136.1| gi|525903774|ref|YP_008292017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]