SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334772|ref|YP_005888719.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334772|ref|YP_005888719.1|
Domain Number 1 Region: 92-383
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.25e-72
Family C5 cytosine-specific DNA methylase, DCM 0.00012
Further Details:      
 
Weak hits

Sequence:  gi|385334772|ref|YP_005888719.1|
Domain Number - Region: 2-52
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0163
Family DNA-binding N-terminal domain of transcription activators 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334772|ref|YP_005888719.1|
Sequence length 406
Comment cytosine-specific methyltransferase [Mycoplasma hyopneumoniae 168]
Sequence
MKYYKISEIANLEAVSQKFIRREIARKTLISIKKNNKYLVSESDYQKWKSSYRKQEKLRK
NLGKTKEKVHFIEISEEMKKLDGWSSSYRNGYNFIDLFSGAAGLSCGLVMAGFLPLASLE
IMKQAVETYAYNFKKRSKNKELFKLGDIRDSKIKSEFYNHFKDQELDLIAGGFPCQGFSM
AGNRVFDDPRNNLYLEMLDIVANLKPKFVLMENVQGLRTMLSGQIEAKIIKDFEKIGYKI
NVATLNSADFGVAQIRKRVIFIANRIGLTNFFPAAILSPENYKTLGQCIEKYMNWEENIE
INHIFTKHSAKMREKILKTSEGQSVYKNYSDGWKKSPWDQPSCTVKKNHGGVNLHPKLPR
VLTPRELAALQSFPDSFIFKGSKKMTTCANWKCGAPTFSKGYRPGY
Download sequence
Identical sequences E4QTS0
gi|507383031|ref|YP_008026033.1| WP_014579994.1.28423 WP_014579994.1.29754 WP_014579994.1.62369 gi|385334772|ref|YP_005888719.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]