SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334791|ref|YP_005888738.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334791|ref|YP_005888738.1|
Domain Number 1 Region: 81-157
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.99e-19
Family ScpB/YpuH-like 0.0011
Further Details:      
 
Domain Number 2 Region: 4-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000012
Family Z-DNA binding domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385334791|ref|YP_005888738.1|
Sequence length 195
Comment segregation and condensation protein B [Mycoplasma hyopneumoniae 168]
Sequence
MKTRIIEAILYLQGEKGVSSLQLQNCLKLAKISEARKLLKDFAIEFNRQKRGILVVEFDD
IFKFVTAKDLKPFIIDFVSNEKKYRLSNSSIEVAAIIAYKQPVTRSTIAQIRGGINSDYI
VGSLLAKGIIEELGTASTPGNPTLYGVTSRFFDYFKLRSAKDLPKFQEFDLFSHEDQNSQ
VDNFDLFSSQRENQK
Download sequence
Identical sequences A0A223M8Y1 E4QTT9
gi|507383050|ref|YP_008026052.1| gi|385334791|ref|YP_005888738.1| WP_014580009.1.25027 WP_014580009.1.28423 WP_014580009.1.29754 WP_014580009.1.62369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]