SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334793|ref|YP_005888740.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334793|ref|YP_005888740.1|
Domain Number 1 Region: 1-309
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.8e-33
Family YeaZ-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334793|ref|YP_005888740.1|
Sequence length 322
Comment O-sialoglycoprotein endopeptidase [Mycoplasma hyopneumoniae 168]
Sequence
MKILGIETSHDDASVALFSENKVEILLTISQFELHEQFGGTVPELASREHSRNLAIILEK
LLGKNIDFSTIDAIAYTKNPGLIGPLKIGFLFASALSLFFNKPLIPIDHLLGHFWSAAIE
NDLEFPVLSLLISGGHTQLIFAENKNNLEIIGSTVDDALGEIYDKIGRSLGCGYPGGPKI
DLIWQQNNVRNMELIDFSLPKVLENPLDFSFSGLKTQVINYTNNLKENYLFSQKKVVEIA
VSFQKTVIKYLKRQLDLALKTKKNVKTITLVGGVAANSEIRKLIKTYENKYKVVIPKKEF
CTDNGAMIAKAAQIFLKFNEEK
Download sequence
Identical sequences E4QTU1 Q4A792 Q4A952 Q5ZZQ1 S5FZY5
gi|525903798|ref|YP_008292041.1| gi|71893984|ref|YP_279430.1| 262719.MHJ_0636 262722.MHP7448_0635 295358.mhp656 WP_011206487.1.100269 WP_011206487.1.28423 WP_011206487.1.29754 WP_011206487.1.35737 WP_011206487.1.4867 WP_011206487.1.51147 WP_011206487.1.62369 WP_011206487.1.76180 gi|54020637|ref|YP_116164.1| gi|72080962|ref|YP_288020.1| gi|507383052|ref|YP_008026054.1| gi|385334793|ref|YP_005888740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]