SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385334814|ref|YP_005888761.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334814|ref|YP_005888761.1|
Domain Number 1 Region: 15-181
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.6e-23
Family Glucose-inhibited division protein B (GidB) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334814|ref|YP_005888761.1|
Sequence length 202
Comment Ribosomal RNA small subunit methyltransferase G [Mycoplasma hyopneumoniae 168]
Sequence
MYKRLVQEFFPKLDFENLEKYVNLIEFSNKNFNLTAFSGDILWKEGIFESIFTMNFIVGL
VNNKENKKLKILDIGAGSGFPSIPFLITNPEIELTISESMQKRCQFLKDVSEKLDLKFNL
ICKPVQEINPQKFDIITARAVANLEKLEKITKKIHFPKTLLAFIKGPKVFNEVQNCKNCN
YKIIKVNNNINKKIFIAFKQVS
Download sequence
Identical sequences A0A223M940 E4QTW2 Q4A933
262719.MHJ_0655 gi|71894003|ref|YP_279449.1| gi|385334814|ref|YP_005888761.1| WP_011284377.1.25027 WP_011284377.1.28423 WP_011284377.1.76180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]