SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334819|ref|YP_005888766.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334819|ref|YP_005888766.1|
Domain Number 1 Region: 80-340
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.44e-74
Family Creatinase/aminopeptidase 0.000000933
Further Details:      
 
Domain Number 2 Region: 8-117
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 6.45e-17
Family Creatinase/prolidase N-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334819|ref|YP_005888766.1|
Sequence length 345
Comment XAA-PRO aminopeptidase [Mycoplasma hyopneumoniae 168]
Sequence
MNRKYLEKAFFDNHLDVIISFSFQSRLWLTKIAASDGILFIEKDQAFLFVDGRYIEKAEK
DAKNCQVFLTTKANLEDFFKKKPYQKIGIESEYLTIEQFDKIKGWFPNADFVKLQAQLFR
IIKTEEEIKNIEKAVEISLAAYNKIFPKIKPGMTEKSIDVNLNYQMKLLGAEKESFDSII
ATGSNSAMPHWRASEAEILDNDLLKIDFGALFNGYCADITRTSYLGQISEKKLEILEIVK
KAAEIGRKKVAPGVKACEIDLACRNFITEQGYGKYFIHSTGHGVGIDIHELPVVSSTSQT
ILEPGMVITVEPGIYIPGLGGARIEDVVLVTENGFRTLSRKGEKI
Download sequence
Identical sequences E4QTW7
gi|385334819|ref|YP_005888766.1| gi|507383078|ref|YP_008026080.1| WP_014580027.1.28423 WP_014580027.1.29754 WP_014580027.1.62369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]