SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334834|ref|YP_005888783.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334834|ref|YP_005888783.1|
Domain Number 1 Region: 196-368
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000265
Family Protein kinases, catalytic subunit 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385334834|ref|YP_005888783.1|
Sequence length 733
Comment hypothetical protein MHP168_690 [Mycoplasma hyopneumoniae 168]
Sequence
MPLFLNVRDINYLDKIKYPKRNVTFLEEATFLFIYFNDTKIPNQGWKIHISSLLKCAVNI
LQIVFDYCLKNKINFKFIKNEKLLLKNLSVNTDPFSFGKFITIYSESEENFKIHINWFYN
KLKNFRGVNINSSRAFFDSTNIFYRYGTNYKKTRFLLGPNNQKIRDRKKLEYFLPEFINE
PFPDNKSIFNFEKTILNYRFLILYLVQRTTISTVFFGQDINSKKFIILKASPLYAITAEN
ITLTYFRRNEMKLLLDLTKNNFENSQQYVDSFVSQNNFYICKSFVNGKDLKFILDSINLV
DKKYFNKESQTKYRENFKKAFNCVYNFHKKNIILNDVSAKNFVCDKLRCYFVDLETSYVY
NSKIQKIWEKISLSSAKFPIKSSHFLVDILKLSSIFIESLIGSIQSLKNEFEIRWLFLSL
YNFILFYNWPLWLLTDIFEVFRKQGFINKNNNSNLLKKIFDQPKTLTFKNIIEKIRNIYK
IYSVKKPLKFSNFKFEFLYKIINNLQISTNLINKLLNYEKRFKFKNLKNFTTANLIFWGH
WFFLKTKLFENFSNNFYYKKIIEYIFEKRVENVDGKLIVRDKKQYSPYIWNGSLGLCYLI
LKSKYKKYNKQIGLLEKSLIRTTSTKINFFHGISGFIHYFGQKKSAKIYYKQILRWIIFI
LNFWDDEKGFFIDNIFPYSHKNFILVNSLIIETINEFIKNKDFINFFSRGDLKIPSYNTK
IYNSILEISKIFA
Download sequence
Identical sequences E4QTY4
gi|507383092|ref|YP_008026094.1| gi|385334834|ref|YP_005888783.1| WP_014580040.1.28423 WP_014580040.1.62369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]