SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385334620|ref|YP_005888567.1| from Mycoplasma hyopneumoniae 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385334620|ref|YP_005888567.1|
Domain Number 1 Region: 64-137
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.7e-21
Family Ribosomal protein L11, C-terminal domain 0.00036
Further Details:      
 
Domain Number 2 Region: 4-66
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 8.11e-18
Family Ribosomal L11/L12e N-terminal domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385334620|ref|YP_005888567.1|
Sequence length 149
Comment 50S ribosomal protein L11 [Mycoplasma hyopneumoniae 168]
Sequence
MAKKNVVRVAKLQFNAGQAKPGPALAGLGIVMPEFTRKFNDETKNRGDEPVPVKITVFKD
KSFEFQLFTSPTSYKIKQAAKIESGSKKSKTEKVGKITFEQLREIAEYKLPDLNTESLDK
AILTVYGTAMQMGVEVEGIEEFIQKQGGK
Download sequence
Identical sequences E4QTB8
WP_014579885.1.28423 WP_014579885.1.29754 WP_014579885.1.62369 gi|385334620|ref|YP_005888567.1| gi|507382885|ref|YP_008025887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]