SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ANID_04159T0 from Aspergillus nidulans FGSC A4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ANID_04159T0
Domain Number 1 Region: 109-354
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.17e-73
Family Glutamine synthetase catalytic domain 0.0032
Further Details:      
 
Domain Number 2 Region: 19-106
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 2.49e-21
Family Glutamine synthetase, N-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ANID_04159T0
Sequence length 357
Comment | ANID_04159 | Aspergillus nidulans FGSC A4 glutamine synthetase (358 aa)
Sequence
MTDSTNVSNTENLMKYMSLDQRGSVMAEYIWIDAHGGTRSKTKTLSKAPSSVDELPEWNF
DGSSTAQAPGDNSDVYLRPVAMYPDPFRRGDNILVLCETWDSDGSPNKFNYRHDCARLME
THAKEEFWFGLEQEYTLLGPDGWPYGWPKGGFPGAQGPYYCGVGTGKVYCRDIVEAHYRA
CLYAGVKISGINAEVMPSQWEYQVGPCHGIEMGDHLWISRFLLHRVAEEFGVKISFDPKP
IKGDWNGAGLHTNVSTTSTRAEGGIKAIESYMKKLEARHVEHIAVYGEGNEERLTGRHET
GNIDKFSYGVADRGGSIRIPRQVAKDGKGYFEDRRPASNADPYQITGIIAETLCGGL
Download sequence
Identical sequences Q96V52
162425.CADANIAP00004514 ANID_04159T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]