SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ANID_04819T0 from Aspergillus nidulans FGSC A4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ANID_04819T0
Domain Number 1 Region: 538-863
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 7.85e-72
Family Glutamine synthetase catalytic domain 0.00033
Further Details:      
 
Domain Number 2 Region: 180-411
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 5.07e-34
Family TatD Mg-dependent DNase-like 0.052
Further Details:      
 
Weak hits

Sequence:  ANID_04819T0
Domain Number - Region: 434-527
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0034
Family Glutamine synthetase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ANID_04819T0
Sequence length 865
Comment | ANID_04819 | Aspergillus nidulans FGSC A4 extracellular developmental signal biosynthesis protein (866 aa)
Sequence
MATLSSLRHLIQTHPLIDNHAHNLLSQSAACKYAKYPFEQIISEAQGVALANAPSTLSFH
RAASQLATLYQSSSSDWDSVRAARDQSVQRDYEGLIRKCLEGTQVLLLDDLLTENDVELF
DWHDRFTASATKRIVRIEALAASVLSQIVHGGPVPQDSSDLSAFQTLWESFSRNFSALVS
DAIADPAVVGFKSVICYRTGLDVQPTDDRDTERLIRSFARTISQAAVSTPRVEDKPLNDW
LVRQTLNLLKAAKVTQPNKPLQLHTGLGDNDINLLKSNPAHLQSLIAQYPEVDFVLLHSS
YPYTREAGYLACVYPNVYLDLGEVFPMVSRDAQESILRESLEIVPSTRLLWSTDGHFFPE
TFWLANRQFRDALEKVFVDYVQNGDYTIEQAMQAAADILFHNSNRLYELNEQPPSAALSS
GHQTVSRISSTDLLEKFIRSNPGVKYVWTQFIDYTATVRVRMFPVMEFAKIVRKQRRLGI
SMATFWMLQDDEVVGGSTTGQFYLIPDLSTLSPNVGIDSKSATVMTWWKSEQGESLEECP
RTNLLNINNKLKDEFGIQATCGFEIEVVFLKPTTDPSTGEEDWAPSVTNHSWSQMTRETR
RMLPLLEEIAETLASIGIHLQQFHAESAPGQFEFILPPDNPVAAVDTLIKSRQVIANIVE
KHGLRATLYPRPYPSAAGTASHAHVSISPSTKEESFLAGVLQHYPAVLAFTLSGDASYDR
VKSGIWAGSEWVTWGTQNREAPIRKISPGHWEIKSLDGLANMYLAMAAFLAAGYTGVKEN
LPLTIKDCPYDAASLPESERAALGITTKLPNTLAKSLAALESDEILRSLLGENLVEDYII
VKRAESKKLSAMDEKARRKWLVERY
Download sequence
Identical sequences P38094
162425.CADANIAP00005600 XP_662423.1.1458 ANID_04819T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]