SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|522649815|ref|YP_008192278.1| from Alteromonas macleodii str. 'English Channel 615'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|522649815|ref|YP_008192278.1|
Domain Number 1 Region: 63-200
Classification Level Classification E-value
Superfamily CBS-domain pair 4.3e-35
Family CBS-domain pair 0.002
Further Details:      
 
Domain Number 2 Region: 203-282
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.67e-20
Family CorC/HlyC domain-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|522649815|ref|YP_008192278.1|
Sequence length 285
Comment Mg/Co transporter [Alteromonas macleodii str. 'English Channel 615']
Sequence
MSDDNPHSTNGSSGKSWLDKLKNSISGEPRSKEELVSVITDAEQNDIIDPQTREMIEGVI
GVNEMRVRDIMIPRAQMTTIDVEKKVEEFLPLMLESAHSRFPVISEDKDHIEGILLAKDL
LAFAFNAEKEFNLKDILRPAVIVPESKRVDVLLKEFRQQRYHMAIVVDEYGGVSGLVTIE
DILEIIVGEIEDEYDTEEDGTDDIRPLNKSTYSVKALTPVDDFNEFFETKFSEEEADTIG
GIVLKAFGHMPETNDEITIGDIQFKVTNSDKRRLIQLKVSVPSLE
Download sequence
Identical sequences A0A1J0SPQ9 F2G6N3 S5ALW6 S5BX91
gi|522649815|ref|YP_008192278.1| gi|410861150|ref|YP_006976384.1| gi|522568992|ref|YP_008171421.1| gi|522613752|ref|YP_008179442.1| gi|332140830|ref|YP_004426568.1| WP_012517912.1.21115 WP_012517912.1.24997 WP_012517912.1.30323 WP_012517912.1.34434 WP_012517912.1.35093 WP_012517912.1.36926 WP_012517912.1.48123 WP_012517912.1.50651 WP_012517912.1.52576 WP_012517912.1.68468 WP_012517912.1.81623 WP_012517912.1.96561 gi|522589492|ref|YP_008175569.1| gi|566717968|ref|YP_008918290.1| gi|522815279|ref|YP_008183508.1| gi|522667367|ref|YP_008195829.1| 314275.MADE_02233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]