SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|522651253|ref|YP_008193716.1| from Alteromonas macleodii str. 'English Channel 615'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|522651253|ref|YP_008193716.1|
Domain Number 1 Region: 5-55,99-353
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.53e-24
Family ADP-ribosylglycohydrolase 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|522651253|ref|YP_008193716.1|
Sequence length 357
Comment hypothetical protein I633_16815 [Alteromonas macleodii str. 'English Channel 615']
Sequence
MASLMIERAKAALKNAFVGDALAMPVHWFYNPADIYKAFPLGIEQFEDAPSFHPSSIMSL
HSTQQGGRANKASASQKEIVGEIILKGKRQYWGKDNIHYHQGMKAGENTLNAHCARIVLT
CALKGYDTDQFLNQYISFMRADEPKHPDTYAESYHRGFFANLEQGTPAEKCGAVTHDTAS
IGALVSVTPLAVVEAAKHTALEDVKRLCRSHLYLTHPDESLASVCDFYVELIYKLMHRED
EPPKDILGEIARSSAGMNLAELTAKNKSDIEIVGRMYSPACYISDAWPAVLYFAYRYADT
PKKALMANTNVGGDNVHRGFVLGALLGLIHGVEITPWFSELTDAKKLNSLIDSLDIQ
Download sequence
Identical sequences S5AJA4 S5CCS4
gi|522615465|ref|YP_008181155.1| WP_015067976.1.24997 WP_015067976.1.30323 WP_015067976.1.68468 WP_015067976.1.96561 gi|522651253|ref|YP_008193716.1| gi|410862861|ref|YP_006978095.1| gi|522816845|ref|YP_008185074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]