SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ANID_06654T0 from Aspergillus nidulans FGSC A4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ANID_06654T0
Domain Number 1 Region: 119-473
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.67e-92
Family Glutamine synthetase catalytic domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 19-113
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.000000471
Family Glutamine synthetase, N-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ANID_06654T0
Sequence length 475
Comment | ANID_06654 | Aspergillus nidulans FGSC A4 glutamine synthetase (476 aa)
Sequence
MSATEVTSENVAQILQNDTRVKLAGVDADGMLRGKLVSKKKFLSVVDEGFGFCSVIFGWD
MHDRTYFRELGISNKENGYRDLLAKPDLSSFRRIPWENNVPFFLVSFYDPDTKEPLFACP
RSLLRMALRKPEAQGYRAMAGAEYEFYQFATPNRNASSTASFLKENPVEALPSITDGMFG
YSLTRPIHNQDYYYGIFDACEQFNCEIEGWHTESGPGVYEAFGEAKGMADKAGLFKYVVK
SIGTKHGITPTFMAKPREGLPGNSGHMHISLVNSDDTNAFHRSTPDPSPPYPDVAYLSDL
GRCFLAGILTGLPDIMPMFAPTVNSYKRLVENFWAPVTVSWGLEHRAASIRLITPPTASP
KATRLEVRVPGADANPHFVLAAIVALGWWGVEKKLEIPVPPLSKGEDMGGESDKGVRLAK
NLGAAIATFTRKDSVAREVFGDAFVDHFGGTREHELRLWEEAVTDWEVRRYIETV
Download sequence
Identical sequences ANID_06654T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]