SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Afu3g03270 from Aspergillus fumigatus Af293

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Afu3g03270
Domain Number 1 Region: 22-221
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 2.62e-26
Family Isochorismatase-like hydrolases 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Afu3g03270
Sequence length 238
Comment | Aspergillus fumigatus isochorismatase family hydrolase, putative (239 aa)
Sequence
MRFITVLQTIALLAASMTVKAWNQLDKENAAVLIIDYHVGLAQLDRDFNTNDFRNNMLAH
AALGNLFDLSVVMTTSSDAGPNGLTIKEVVDLNPNVTIVHRQGEVNAWDNAEFRAAIQAT
GKKQLIVSGIVTEVYRHRLLGPLAHRRRIRGLANTEASGTFDDKLAADANRRMEKAGVTL
MGTFGVVTDLMRDWRNTPGLDQVLPYLDKYQYACGLVARHHAGALENGTLAAVESTLI
Download sequence
Identical sequences Q4WF69
Afu3g03270 XP_748646.1.65241 5085.CADAFUAP00000115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]