SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Afu4g03710 from Aspergillus fumigatus Af293

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Afu4g03710
Domain Number 1 Region: 116-432
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 6.47e-68
Family Glutamine synthetase catalytic domain 0.00015
Further Details:      
 
Weak hits

Sequence:  Afu4g03710
Domain Number - Region: 21-100
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.00127
Family Glutamine synthetase, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Afu4g03710
Sequence length 580
Comment | Aspergillus fumigatus glutamine synthetase (581 aa)
Sequence
MSQDTITVEDLPALLEHDISVKVAGIDCDGILRGKVMAKEKFLGIAQKGFGFSSAVFGWD
MQDVLYTTDAKIAPPESGYVDFIAVPDLSSYRRIPWEDNIPFFLVRFVQNEKPVAADGRS
MLRAITDKLAEANCQAMAGVELEFMNFQTPSQDGYSNGSQTRDIAAFLERNAPSALRPMT
AGSFSYSATRPVAFKKYFWDIFNTSARFNCGIEGWHTEGGPGVYEAPMYGQPGSSGHIHI
SLCDLEGKNLFARDTPDPNALWSDAACLSDMGRQFLAGLLEALPDIMPLFAPTINSYKRL
VENYWAPVNISWGLEDRMASIRIITPPVCKPGATRMEVRIPGADLHPHYALSVILAAGWR
GIEKKLDIKVPPMSALKQGERPELLPNTLEEAIKRFSAPESIAREILDGEFVDFFTATRQ
HELKVWREAVTDCIDPLSYAMDFSLQNHRSFIGRPATDLPTPAVVLSKPILERNIKQLLQ
DVKDLEISFRPHVKTLKSIEVTRMMLGNGTHRRIVASTLCEIRGALPLAEEGILDEVSSP
VLPPATQQQTLTPCAREKGSLRHPHLPQRAPPARSPLIKA
Download sequence
Identical sequences Afu4g03710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]