SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Afu4g13120 from Aspergillus fumigatus Af293

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Afu4g13120
Domain Number 1 Region: 154-400
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 3.27e-73
Family Glutamine synthetase catalytic domain 0.0025
Further Details:      
 
Domain Number 2 Region: 92-151
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.00000000000000471
Family Glutamine synthetase, N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Afu4g13120
Sequence length 413
Comment | Aspergillus fumigatus glutamine synthetase (414 aa)
Sequence
MAETSTVVSNTENLMKYMSLDQRGHVQAEYVWIDAVGNCRCKTKCDCGHGFHSIGMGVQS
GDKMIYGYHLLWLLGCRASDMGRAVILNTLSKPVKSVDELPEWNFDGSSTGQAPGDNSDV
YLRPVAIFADPFRRGDNILVLCETWDSDGTPNKFNFRHEANRLMEIHAKEEFWFGLEQEY
TLLGTDGWPYGWPKGGFPGAQGPYYCGVGTGKVYCRDIVEAHYRACLYAGIKISGINAEV
MPSQWEYQVGPCQGIEMGDQLWMSRFLLHRVAEEFGVKISFEPKPIKGDWNGAGLHTNVS
TAATRAEGGLKVIEAYMQKLEARHNEHIAVYGEGNEERLTGRHETGSIDKFSYGVADRGG
SIRIPRQVAKDGKGYFEDRRPASNADPYQITGIIVETLCDVFDIKTKCADIFI
Download sequence
Identical sequences Afu4g13120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]