SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Afu5g09220 from Aspergillus fumigatus Af293

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Afu5g09220
Domain Number 1 Region: 1894-2190
Classification Level Classification E-value
Superfamily BEACH domain 7.32e-124
Family BEACH domain 0.0000000354
Further Details:      
 
Domain Number 2 Region: 1730-1856
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-26
Family PreBEACH PH-like domain 0.013
Further Details:      
 
Domain Number 3 Region: 2245-2363,2428-2521
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.85e-22
Family WD40-repeat 0.0054
Further Details:      
 
Domain Number 4 Region: 340-544
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-18
Family Laminin G-like module 0.068
Further Details:      
 
Weak hits

Sequence:  Afu5g09220
Domain Number - Region: 956-979,1030-1066,1380-1503
Classification Level Classification E-value
Superfamily ARM repeat 0.000633
Family PBS lyase HEAT-like repeat 0.092
Further Details:      
 
Domain Number - Region: 68-185,212-268,946-1065,1248-1511
Classification Level Classification E-value
Superfamily ARM repeat 0.00096
Family Clathrin adaptor core protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Afu5g09220
Sequence length 2526
Comment | Aspergillus fumigatus Beige/BEACH domain protein (2527 aa)
Sequence
MSKPTSNLPPFASSSTEQSAAVTELAPLIQELKAICDNCDKQTFASQQFLTATESLLRLR
HTFLDNDRPREAQEAFRHLNGFETLLQLVKKLSHLYEPTELSAEERRSLLTLYKDALAVL
AESLKGNFGNRRYFARRISGGGTAALQEALDIIVPKLSSAQGDTEQFYGGILAAALCQEA
VADIFTTLNAKFQPVQELLQQDVKAEVDRRMGSSETVEVPELLGPFLKGWLKQSGSSPSD
YRVQRLVLPACLCQLAHQSQRNLTALHATGILSSILPILFGSDRLESERIIYQDMAQLLC
AQGLTSLEDAATLYRQAHGCARILRFLVDVLKCSKEPPLIQFDLSLHGYSSLEFSTLGRP
FPPVTSSGYTIAVWARFDRFDPSTHTTIFGAFDASQSCFLLVYLERDTRNFILQTSIRGT
RPSVRFKSMAFEPNRWYHICVVHKKPRPPSHSRASLFIDGEFVEQLRIDYPCVPVSNTPN
RMPRVQAFFGTPQDLAMKLGKAVSVSRWSLANAILFEEAHSDDMVAVFYNLGPRYFGNFQ
DCLGSFQTYKASATLNLRNEHLHPGKEETSDIVTAIRQKASVLIREGSILINISPMSVLD
DDDINNIDESQLIKSLSRKAVKNLHLLTKAGGNAVAANGAVPSLNDALTQAHGMGVLTGD
PVVSVPHSLDDVSWRIGGCVAVHLSLVHAAKTPECLSLAVEALYEAVQDNWRNSEAMERE
NGYGILAAILRDKFGLGNSSATSRASSICSNLEERCALGLDLLRLTLKFVGYDFEHPNRS
IITNPLAYRVLLVDLDIWRLGDSAQLSLYYSQFSTFAGESNYRRFNAKRLSRMRVNKRLL
EALKGDEFTSESLTLLVSAFRSLLESCLSADLFRSLALFITYAIHKTREPSRLQKKKSLR
FTDGSPQIARSAEQGDYVSSTKIAVEMLRMYSSVLCDSHDLIPLKKFARSVTNKWLLYLI
CEDDPEIVALATKILARLIVIHGDVYSKKFSEKTGGYIIMRHRLRSWWKVPAIWCICLSI
LLGLDVGGMKLDQPFSRTGLIEILSSNSQPRVAFPEILPVLMEMMQLGLQSVISGDELSS
GVHGKSLQKSEVRLESPPASLTIRVTELTKQISLLDAVVGLFADLHQNSTDFRDFAAQSD
YVQWLLYVTFPVVVGSDIPSTDFELKSRAAKTNSHDHTLPVRPRSSGTAGLRTTTVEGSS
SRERQAGPLRRGSSFILVSSDRTKFSPSFARIHKAFIPFGSPPDMTATDHPLVQAILSLV
LSVFCDQLLERKDFAGLGLYLKTPTSTLEQQSYFNSWILRSLLTRLRDVTISKPQVLLEP
RALSNMGRFATHIGEAVYEGWFIDGATHALEFAGAILEYLQQSNVSSLKSVRLCSQAVTT
IRSTLFRVVLLKLSEVDDREACEFLSRLSYWQVVLLSEGEVQSDYLRLLCYLLYTKLISQ
DWNVRLAAAGLWRVILVQKPAEMSAILSQAAIPLQKRLSDGFEALVGMEDKAFLQWVDGH
QDDLNAMFLGLLSRSWETFVQEESSNIDSTTRARASKRQEKLRHWNQLERLSEEVTRKHE
TTFPHWVSNISASEFLKHQRALQDQQDNSVFMWTAFSHMTMDLKRFGGVLAEDKDRKWRL
DQTEGRSRMRLRMVPDESGERQDYQPKRKASEPPAIKIDTQVQPSSNGNTTGLTPTVLAA
ENMDDNQQDAHSDSRSVLEESFEMIDDPKADLEDYEDKNRKVMRSLHRGDQVENVCNMSR
IIGLEACEGLLILGKDHIYILDNFFQRSDGEIVNVWQAPPDERDPYVRMIAGRESFERRT
QEHATRSWKWSDLVSVSKRRFLFRDVALEVFFTDGTSYLLTLISSRARDNLCSQLASKAP
QVTGSASHSRPEDVWRFETLRSQEDAPQSLGSKFASVFGHSPLHPATRKWIKGEISNFHY
LMLINTLAGRTFNDLTQYPVFPWVLADYTSEELDLTDPKVFRDLSKPMGCQTLEREAEFR
ERYKAFAEMGDGDAPPFHYGTHYSSAMIVCSYLIRLQPFVKSYLLLQGGTFDHADRLFYS
IGKAWESASRGNMSDVRELTPEFFYLPEFLVNSNKYDFGLLQNMTTAIDSVELPPWAKGD
PKIFIAKHREALESSYVTENLHHWIDLVFGCKQKGEAAIEAVNVFHHLSYQGAKDIDNID
DPVERLATIGIIHNFGQTPHQIFTRPHPPREDTRHKVPRLDRLAESLTQLPLSLLDIGEQ
VSTLSMKNDRLLCAAPLRLNIPPNYDKYMEWGFFDGSVRFYSADSRKILGHFEHLHIGQL
SCTIFADSRTLVTSGTDCVVSIWTYNSTAKSVDLQPAGSLFGHRNPVNVLAVSRSFSALL
SASTDGQIMLWDLNQHTFVRELPASGPVDVSDARKLTKRPCSFRQRLTSAQCARINDVTG
EIMVCRGNRISIYTLNGALLLEQDVCESIDDRVMSCVFYEGVDNEWQERELIFTGHRKGV
VNIWNKVSRDGRFELELIRQLHHIDNNRDNGANISAGISCILTLPHVVYTGDEAGRVYEW
NCVQRR
Download sequence
Identical sequences Q4WUP7
XP_753717.1.65241 5085.CADAFUAP00006588 Afu5g09220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]