SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118431027|ref|NP_147206.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431027|ref|NP_147206.2|
Domain Number 1 Region: 85-198
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.000000000131
Family V-type ATPase subunit E 0.0041
Further Details:      
 
Weak hits

Sequence:  gi|118431027|ref|NP_147206.2|
Domain Number - Region: 16-100
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.012
Family Apolipoprotein A-I 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118431027|ref|NP_147206.2|
Sequence length 200
Comment V-type ATP synthase subunit E [Aeropyrum pernix K1]
Sequence
MAKVQGDPRRFADTVLEKPFKEALARVEEAREAGLKLVEEAYKSALSAARKRLESRVEEA
RERLQGLKSKADLEVRTEAERVKDELVSRLIEEALAEFRRRKAGMESYRQYLERVLGSAA
GESGGSVAKVLCAPEDEEIVREVLGKLGLDGVSVEAVEGIYGGVVVELAEGARLDYTVNN
IIAAEEPRLRRAVKRALFEA
Download sequence
Identical sequences Q9YF31
gi|118431027|ref|NP_147206.2| 272557.APE_0409.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]