SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118431110|ref|NP_147334.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431110|ref|NP_147334.2|
Domain Number 1 Region: 99-260
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.97e-33
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 2-98
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 1.38e-20
Family Shikimate dehydrogenase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118431110|ref|NP_147334.2|
Sequence length 273
Comment shikimate dehydrogenase [Aeropyrum pernix K1]
Sequence
MIRLALFGSGVSSSLSPAIYRGFAAKRGLRLEYRVYEAGPGGLAPALRMAGELHGFNVTK
PLKREALSLASTLDSHARAIGAVNTMVAGEEGWEGFNTDWKGFLDSLKLYTASPPDTALV
IGAGGAGRAAAYALATWGAGRVLIASRTGLTARRAAQDLAGLGAEVEPVPPGGLEDAAAA
SDVVVNATPLGWDGVSTPVERGFREGCIAVDMVYRPLATPFLRRAAASGCTPVDGLWMLA
IQAAENIAVWLGLEASPVELRTYALEAMRGGRG
Download sequence
Identical sequences Q9YEK4
gi|118431110|ref|NP_147334.2| 272557.APE_0574.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]