SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118431325|ref|YP_874873.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431325|ref|YP_874873.1|
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 4.71e-18
Family Ribosomal protein L39e 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118431325|ref|YP_874873.1|
Sequence length 51
Comment 50S ribosomal protein L39 [Aeropyrum pernix K1]
Sequence
MARNKPLGRKLRLARALKSNRAIPVWVVIRTSRRIRFNLLRRHWRRSKLKV
Download sequence
Identical sequences P59472
272557.APE_1087a gi|118431325|ref|YP_874873.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]