SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118431338|ref|NP_147736.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431338|ref|NP_147736.2|
Domain Number 1 Region: 4-183
Classification Level Classification E-value
Superfamily ITPase-like 7.06e-56
Family ITPase (Ham1) 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118431338|ref|NP_147736.2|
Sequence length 188
Comment deoxyribonucleotide triphosphate pyrophosphatase [Aeropyrum pernix K1]
Sequence
MARRILLVTGNRGKLEEAREVLREYGVEVEQAQAWKLEVQSESLEEIALRAARVAYAQLR
RPLAVEDAGLFINALNGFPGPYSSYAYKTIGIPGVLRLLEGAADRGACFKAAVAYVAPLV
ERVFTGEVCGSIAREPRGSQGFGFDPIFVPEGYSSTFAELGPGVKNRISHRARAFRRLGE
WLSRRDPL
Download sequence
Identical sequences Q9YCX4
272557.APE_1138.1 gi|118431338|ref|NP_147736.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]