SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118431362|ref|NP_147783.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431362|ref|NP_147783.2|
Domain Number 1 Region: 259-617
Classification Level Classification E-value
Superfamily SIS domain 2.97e-89
Family double-SIS domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 2-231
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.86e-65
Family Class II glutamine amidotransferases 0.00000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118431362|ref|NP_147783.2|
Sequence length 617
Comment isomerizing glucosamine--fructose-6-phosphate aminotransferase [Aeropyrum pernix K1]
Sequence
MCGIIGLAFAEGNSVAGALVRGLKRLEYRGYDSMGVAVIEPPGRLVVRKAAGKIGEVVRR
TGVLSLRGRVGIGHTRWATHGPPNDVNAHPHTDCGGRVAVVHNGVIRNYASLRRELEARG
HRLVSETDTELVAHLIEEYLGRGYSFLEALSLLGRVLRGSYALALLHLGEPDKVYFLRYK
SPLVVGLGEGVNAVASDITAVLDVARDVIVLEDGEFGWISPEGVAIYRPRGDGGFEPLPP
GALEERVKRVEWTPESASKAGYPHFMLKEIYEQPRALAETFEGIIEDPALLRAAGLVAGA
GRLLIVGAGTSFHAGLVGHYYLSRLAGILGHPVVASEHKVYTPGVDGETVVVAVSQSGET
YDTLEAVREWRGRGARVIGVTNVVGSALDREADVTLYLRAGPEIGVAATKTFLAQTILLQ
TLSIAAAGEAGRLTSGETRELTGVLEGAPDAARRAILASEGAAREAASLLKGAGSMYIIG
RGLGGRLAMEAALKVKEVSYIHAEAYPAGESKHGPIALVEPGFKVYVVATSDSPEVMGNA
IEMKARGASVTVVAPSDLQLDTPEGIEVLKMPPTGGETLLDPYSLTPYFQLLAYHLAVAR
GYDPDKPRNLAKTVTVE
Download sequence
Identical sequences Q9YCQ6
272557.APE_1205.1 gi|118431362|ref|NP_147783.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]