SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118431785|ref|NP_148467.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431785|ref|NP_148467.2|
Domain Number 1 Region: 184-317
Classification Level Classification E-value
Superfamily vWA-like 0.000000000377
Family Integrin A (or I) domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118431785|ref|NP_148467.2|
Sequence length 361
Comment CoxE-like protein [Aeropyrum pernix K1]
Sequence
MQKGGLEERVVEFARLLRENGIRCTVAESIDAALAASLVGMEDLERLKQALRAALAKDPG
RHRLFDYLFDVYWRGAWTAVQVPGRRIAVRVEVEPGSPVERFLSIYSPVEASWGEPGVEP
PSAAQARALYRSLALLRRRLGLEEGRRRVPRRRGRIDFKRSMRRSLRTFGETVRLVRASR
KRSKTDILVLLDVSNSMKDYWPWILGILNALRRLPPGSYEAFLFSTRLVRATPMVEAAGG
AEDLRRLLSRVEGLWGSGTRISQSVEELLESHTPALHRGAAVLVFSDGWDLGDLGRLASA
LAELRRRAGFLVWVTPESPRRDAGGEPSTMRIIRRHADLTIDLETLLNTRRLLRLLPRSS
A
Download sequence
Identical sequences Q9Y9R7
272557.APE_2221.1 gi|118431785|ref|NP_148467.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]