SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118431811|ref|NP_148511.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431811|ref|NP_148511.2|
Domain Number 1 Region: 100-203
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 6.22e-17
Family Cytidylyltransferase 0.011
Further Details:      
 
Domain Number 2 Region: 8-91
Classification Level Classification E-value
Superfamily AF1782-like 2.49e-16
Family AF1782-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118431811|ref|NP_148511.2|
Sequence length 246
Comment cytidylyltransferase [Aeropyrum pernix K1]
Sequence
MATEADVIAERALKYIRNAKTAVERLKSRLGQENDRRSISIDIESLIDAAERYVGDAEYY
AAKGDYATALSAASYAEGLIDSLKYLGVLEPEWPDEGFEEKRVFVGGTFEILHPGHVELL
RYASSLGKLYVVIARDSTVEKIKGRKPILGEKSRLKVVSAVRYVYNAFLGSEKDFLDSVE
KVKPDIIVLGPDQGFDEEQLAAMVEARLGYRPEVVRFGYKLEFEQGIKGVRDIYREVCSR
LCNSES
Download sequence
Identical sequences Q9Y9K7
272557.APE_2281.1 gi|118431811|ref|NP_148511.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]