SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14600666|ref|NP_147185.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14600666|ref|NP_147185.1|
Domain Number 1 Region: 504-617
Classification Level Classification E-value
Superfamily vWA-like 0.0000000286
Family Integrin A (or I) domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|14600666|ref|NP_147185.1|
Sequence length 659
Comment hypothetical protein APE_0370 [Aeropyrum pernix K1]
Sequence
MSRGLRLEEIASGLPAAAEALRRQGHRLGTSELVDIIRLARSYADLEGRDFLAEDELEMV
VDAVVKHRRLSHAIVEELRRASSSSRFRERVERLESEIMAGLQAMGAKPGWRVSKKKVSR
RGREAIAAYMMLRSVGAIQGRPGRERVADAQSLRSLAYTLARQGVESLREAYLSKPSRGG
RERRLMEAESGLAPRLAELDEKGLVELGWASMRKGNARLLKDVGVELARRARTGSLSRVR
DAYKIMRRAGALDRETLSLMIASDPSLASAPEADANTIARAVGIAGHERGGEILAKRLRE
AGPGEAETLVSKVPPEALWAVKSHSLDGWKGELVDAASKAAASLRSALRYMEGGGEGWRE
LGYSMALEAISRASRIGEAASMGGLSRGAVFGMAETAIAILELESSRPSDPERVYSILSR
LSLPAAVKVLRSLYSKASVEEREVLVRSMERLLYKYSVRHGLRLLPKTVLSQRRSPRVDV
RRSIYQSIRSGRPSIVYRERLRAGRLSLALDVSSSMIDYSSWAIAVASLFLSNISRLVIF
SHASTILEGPLSRREVARSLLSVEFRGYTDISTALEKAAHPGVKKIVAVSDLQQTVDSQP
LQLVVRSLHRSGYRIAFITPPSARPEDVEAAREAGARVVTAWTPRQAALGVLRHILRRP
Download sequence
Identical sequences Q9YF71
gi|14600666|ref|NP_147185.1| 272557.APE_0370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]