SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14601347|ref|NP_147883.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14601347|ref|NP_147883.1|
Domain Number 1 Region: 93-196
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 4.71e-16
Family Multidrug resistance efflux transporter EmrE 0.0074
Further Details:      
 
Weak hits

Sequence:  gi|14601347|ref|NP_147883.1|
Domain Number - Region: 2-51
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00235
Family Multidrug resistance efflux transporter EmrE 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14601347|ref|NP_147883.1|
Sequence length 197
Comment hypothetical protein APE_1345 [Aeropyrum pernix K1]
Sequence
MDASITALVTALATPLTYIAAVVLGLEKATLLATAGAFISVAGTYLVLSPQPGSTVSIIG
FLLAFGAALSWVIYTLILRVKLAGYDQNVVMFWTSLFGTVFTVPAYIALAPRGGLEVGLL
EAALILYVAAVPGALGYTLWNLGVERVGASKSAVFIPLVPLTAAILGWLLLGETLSIKQA
IGATLIIAGIVAVVWRR
Download sequence
Identical sequences Q9YCA9
gi|14601347|ref|NP_147883.1| 272557.APE_1345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]