SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14601547|ref|NP_148087.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14601547|ref|NP_148087.1|
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily GlnB-like 5.93e-34
Family Divalent ion tolerance proteins CutA (CutA1) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|14601547|ref|NP_148087.1|
Sequence length 106
Comment CutA-like protein [Aeropyrum pernix K1]
Sequence
MSRVKVVLVTAPKGDGDRLAREIVEQRLAACVNVVRGIKSYYWWEGSINLDDEDLLIIKT
SEEKLDSLIKAVKEMHPYSVPEILALDVSRGNESYVEWVVKEVGGG
Download sequence
Identical sequences Q9YBC9
gi|14601547|ref|NP_148087.1| 272557.APE_1668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]