SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14601649|ref|NP_148190.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14601649|ref|NP_148190.1|
Domain Number 1 Region: 8-95
Classification Level Classification E-value
Superfamily AlbA-like 6.37e-33
Family SCOPe 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14601649|ref|NP_148190.1|
Sequence length 102
Comment DNA/RNA-binding protein albA [Aeropyrum pernix K1]
Sequence
MACEGAPEVRIGRKPVMNYVLAILTTLMEQGTNQVVVKARGRNINRAVDAVEIVRKRFAK
NIEIKDIKIDSQEIEVQTPEGQTRTRRVSSIEICLEKAGESA
Download sequence
Identical sequences Q9YAX2
000991697|e3u6yA1|328.1.1.1|A:1-102 cath|current|2h9uA00/2-102 cath|current|3u6yA00/1-99 cath|current|3u6yC00/1-99 ape001001823.1 ape001001823.2 2h9u_A 3u6y_A 3u6y_C gi|14601649|ref|NP_148190.1| 272557.APE_1823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]