SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14601684|ref|NP_148225.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14601684|ref|NP_148225.1|
Domain Number 1 Region: 13-134,250-404
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 1.15e-90
Family Substrate-binding domain of HMG-CoA reductase 0.00000268
Further Details:      
 
Domain Number 2 Region: 137-252
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 1.57e-41
Family NAD-binding domain of HMG-CoA reductase 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14601684|ref|NP_148225.1|
Sequence length 421
Comment 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aeropyrum pernix K1]
Sequence
MGSSSGQKPRRLEDLVDKLASGSLSHSRLEKELGNANEAALVRRLYLERLTGASLSSVAS
TILDFQELYGRNIENPIGAVQVPVGVAGPLRINGDYARGDFYIPLATTEGALVASVNRGA
KAITLSGGARAKVIKDGMTRAPLLWTPSVYEAHRLAMWVEDRIEDLRSVVAGVTRHGRLQ
HIYPYIIGNLVWLRLSFSTGDAMGMNMVTISSDRICRYIEENYDGDAKCIALSGNMCTDK
KPAAINKILGRGKYVVAEAVIKGEVVKNVLKTTPQNINLVNVTKNLLGSAAAGSHSFNAH
FANIIAAIFIATGQDAAQVVESSMGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQR
ELLALLGVAGGGNPPGSNALKLAEIIASAVLAGELNLLSAIAAGQLARAHELLGRGGLKI
S
Download sequence
Identical sequences Q9YAS4
272557.APE_1869 NYSGRC-FDAO-14601684 gi|14601684|ref|NP_148225.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]