SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14601786|ref|NP_148327.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14601786|ref|NP_148327.1|
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0000000000105
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.017
Further Details:      
 
Domain Number 2 Region: 79-145
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000000000429
Family PUA domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14601786|ref|NP_148327.1|
Sequence length 146
Comment hypothetical protein APE_2020 [Aeropyrum pernix K1]
Sequence
MDSRLFRLLWGRLALQFSPEAADALLSVEGLEVSFGAGGRVRQVWAGGEPYLTLRAGDGY
FSLSTRAGEFLRRSIAKPRFRVIVGSGVEPVGSVFAKQVVGGDEGLRPGDEAIVVDEEDR
LLGVGRVRIPLAFIRGLDRGEVVRLQ
Download sequence
Identical sequences Q9YAB9
272557.APE_2020 gi|14601786|ref|NP_148327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]