SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118431515|ref|NP_148032.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431515|ref|NP_148032.2|
Domain Number 1 Region: 5-321
Classification Level Classification E-value
Superfamily FMN-binding split barrel 3.61e-90
Family UbiD middle domain-like 0.00000228
Further Details:      
 
Domain Number 2 Region: 322-486
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 3.01e-57
Family UbiD C-terminal domain-like 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118431515|ref|NP_148032.2|
Sequence length 487
Comment 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Aeropyrum pernix K1]
Sequence
MKPIADLRSYLEFLESKDMLRRVSVEASPILEIPEILRRIMYRGSGYAVLFEKVKGHEGF
RIAGNIFCSLDVVRQALGVERLEVIGERLFEPLKGPPPLGIGGKLRSLGEVLSLGKYMPK
AVGRAGFTANVLEGREASFNLIPAFKVWPKDGGRYLTYALVHVRDPVRGVMNMGVYRVMI
AGDKEGVVHWQIHKRGMQAQQDSVEKGERRIPAALVIGSDPGTLLTGAMPVPYPIDKHLF
AGVVRGEGLPVYRLPNGIHVPANAEIVLEGYIDLEDLREEGPYGDHFGYYDKPSRLFPTF
RLERVWHREEPIYYGSVTGKPPLEDVVIGKFAERIFLPAIQTLLPEVVDIDLPPHGVFQG
MAFVSIRKRYPGHGKKALLALMGLGQLSLTKIIVVVDHDINVHDVNQVIWAVSSHVDPQR
DVLVVPHSHTDELDPATPTPMYGSKLGIDATRKLPEEYGGKQWPEEVAPDPETVRLVEGR
WGEYGLD
Download sequence
Identical sequences Q9YBM7
gi|118431515|ref|NP_148032.2| 272557.APE_1571.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]