SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88194851|ref|YP_499649.1| from Staphylococcus aureus subsp. aureus NCTC 8325

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88194851|ref|YP_499649.1|
Domain Number 1 Region: 130-256
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 4.71e-26
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 21-128
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.97e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88194851|ref|YP_499649.1|
Sequence length 271
Comment succinate dehydrogenase iron-sulfur subunit [Staphylococcus aureus subsp. aureus NCTC 8325]
Sequence
MTEQSVKNTPQHETQSKPKQKTVKLIIKRQDTSDSKPYEETFEIPYRENLNVIACLMEIR
RNPVNIKGEKTTPVVWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFP
VIRDLQVDRSRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
CPNVTENNKFVGAQAISQVRLFNLHPTGSMTKDERLNALMGTGGLQQCGNSQNCVNACPK
GIPLTTSIAAMNRETTFHMFKSFFGSDHEVE
Download sequence
Identical sequences A0A0D1HPS7 A0A0E0VPR6 A0A0E1AK74 A0A0E1VID3 A0A0H2WWG4 A0A0H2XHE6 A0A0H3JTV5 A0A0H3JVR1 A0A0H3JZ09 A0A0H3KFW0 A0A1E8WPX8 A0A2K4BAC7 Q2FZC7 T1Y7I3 W8UYK2
gi|386728828|ref|YP_006195211.1| gi|15926733|ref|NP_374266.1| gi|82750756|ref|YP_416497.1| gi|545637488|ref|YP_008587664.1| gi|150393696|ref|YP_001316371.1| gi|470198974|ref|YP_007585374.1| gi|387142760|ref|YP_005731153.1| gi|379014342|ref|YP_005290578.1| WP_000139712.1.100013 WP_000139712.1.100041 WP_000139712.1.100049 WP_000139712.1.100057 WP_000139712.1.10006 WP_000139712.1.100067 WP_000139712.1.100072 WP_000139712.1.100084 WP_000139712.1.100088 WP_000139712.1.100090 WP_000139712.1.100094 WP_000139712.1.100122 WP_000139712.1.10014 WP_000139712.1.100154 WP_000139712.1.100171 WP_000139712.1.100184 WP_000139712.1.100189 WP_000139712.1.100235 WP_000139712.1.100265 WP_000139712.1.100272 WP_000139712.1.100298 WP_000139712.1.100307 WP_000139712.1.100310 WP_000139712.1.10032 WP_000139712.1.100335 WP_000139712.1.100347 WP_000139712.1.100352 WP_000139712.1.100357 WP_000139712.1.100366 WP_000139712.1.100391 WP_000139712.1.100399 WP_000139712.1.10041 WP_000139712.1.100452 WP_000139712.1.10046 WP_000139712.1.100464 WP_000139712.1.10050 WP_000139712.1.10053 WP_000139712.1.100534 WP_000139712.1.100535 WP_000139712.1.100562 WP_000139712.1.100582 WP_000139712.1.100596 WP_000139712.1.100612 WP_000139712.1.100618 WP_000139712.1.100631 WP_000139712.1.100647 WP_000139712.1.100665 WP_000139712.1.100668 WP_000139712.1.100678 WP_000139712.1.100693 WP_000139712.1.100699 WP_000139712.1.100704 WP_000139712.1.100719 WP_000139712.1.100726 WP_000139712.1.100761 WP_000139712.1.100768 WP_000139712.1.100823 WP_000139712.1.100832 WP_000139712.1.100834 WP_000139712.1.10085 WP_000139712.1.100860 WP_000139712.1.100888 WP_000139712.1.100903 WP_000139712.1.100920 WP_000139712.1.100922 WP_000139712.1.100934 WP_000139712.1.100963 WP_000139712.1.10097 WP_000139712.1.100981 WP_000139712.1.100987 WP_000139712.1.101002 WP_000139712.1.101017 WP_000139712.1.101019 WP_000139712.1.101027 WP_000139712.1.101055 WP_000139712.1.101058 WP_000139712.1.101068 WP_000139712.1.101071 WP_000139712.1.101072 WP_000139712.1.101084 WP_000139712.1.101103 WP_000139712.1.10111 WP_000139712.1.101142 WP_000139712.1.101160 WP_000139712.1.101177 WP_000139712.1.101192 WP_000139712.1.101217 WP_000139712.1.101240 WP_000139712.1.101262 WP_000139712.1.101266 WP_000139712.1.101298 WP_000139712.1.101327 WP_000139712.1.101329 WP_000139712.1.101330 WP_000139712.1.101352 WP_000139712.1.101375 WP_000139712.1.101379 WP_000139712.1.101393 WP_000139712.1.101406 WP_000139712.1.101414 WP_000139712.1.101440 WP_000139712.1.101441 WP_000139712.1.10148 WP_000139712.1.101490 WP_000139712.1.101495 WP_000139712.1.101505 WP_000139712.1.101511 WP_000139712.1.101531 WP_000139712.1.101566 WP_000139712.1.101567 WP_000139712.1.101570 WP_000139712.1.101598 WP_000139712.1.101615 WP_000139712.1.101617 WP_000139712.1.10165 WP_000139712.1.10166 WP_000139712.1.101661 WP_000139712.1.101670 WP_000139712.1.101691 WP_000139712.1.101704 WP_000139712.1.101725 WP_000139712.1.101728 WP_000139712.1.101745 WP_000139712.1.101757 WP_000139712.1.101778 WP_000139712.1.101788 WP_000139712.1.101813 WP_000139712.1.101820 WP_000139712.1.101821 WP_000139712.1.101825 WP_000139712.1.101852 WP_000139712.1.101902 WP_000139712.1.101906 WP_000139712.1.101922 WP_000139712.1.101943 WP_000139712.1.101950 WP_000139712.1.101999 WP_000139712.1.102065 WP_000139712.1.102066 WP_000139712.1.102070 WP_000139712.1.102084 WP_000139712.1.10209 WP_000139712.1.102096 WP_000139712.1.102123 WP_000139712.1.102126 WP_000139712.1.102130 WP_000139712.1.102132 WP_000139712.1.1022 WP_000139712.1.10232 WP_000139712.1.10238 WP_000139712.1.1025 WP_000139712.1.10274 WP_000139712.1.10301 WP_000139712.1.10306 WP_000139712.1.10308 WP_000139712.1.1031 WP_000139712.1.1032 WP_000139712.1.10343 WP_000139712.1.10355 WP_000139712.1.10358 WP_000139712.1.10397 WP_000139712.1.1043 WP_000139712.1.10431 WP_000139712.1.10436 WP_000139712.1.10469 WP_000139712.1.10481 WP_000139712.1.10486 WP_000139712.1.10503 WP_000139712.1.1052 WP_000139712.1.10526 WP_000139712.1.10542 WP_000139712.1.10543 WP_000139712.1.10565 WP_000139712.1.10583 WP_000139712.1.1060 WP_000139712.1.10614 WP_000139712.1.10617 WP_000139712.1.10624 WP_000139712.1.10644 WP_000139712.1.10679 WP_000139712.1.10707 WP_000139712.1.10726 WP_000139712.1.10742 WP_000139712.1.10749 WP_000139712.1.10751 WP_000139712.1.1077 WP_000139712.1.10785 WP_000139712.1.10823 WP_000139712.1.10841 WP_000139712.1.10843 WP_000139712.1.10858 WP_000139712.1.1087 WP_000139712.1.10919 WP_000139712.1.10928 WP_000139712.1.10942 WP_000139712.1.10950 WP_000139712.1.1097 WP_000139712.1.10976 WP_000139712.1.10979 WP_000139712.1.10985 WP_000139712.1.11001 WP_000139712.1.11067 WP_000139712.1.11069 WP_000139712.1.11073 WP_000139712.1.11083 WP_000139712.1.11084 WP_000139712.1.11129 WP_000139712.1.1115 WP_000139712.1.11162 WP_000139712.1.11188 WP_000139712.1.1120 WP_000139712.1.11220 WP_000139712.1.11223 WP_000139712.1.11228 WP_000139712.1.1124 WP_000139712.1.11261 WP_000139712.1.11281 WP_000139712.1.11282 WP_000139712.1.11286 WP_000139712.1.11287 WP_000139712.1.11294 WP_000139712.1.11322 WP_000139712.1.11333 WP_000139712.1.11348 WP_000139712.1.11353 WP_000139712.1.1136 WP_000139712.1.11377 WP_000139712.1.11378 WP_000139712.1.11403 WP_000139712.1.11407 WP_000139712.1.11447 WP_000139712.1.11451 WP_000139712.1.11463 WP_000139712.1.1147 WP_000139712.1.11475 WP_000139712.1.11488 WP_000139712.1.11492 WP_000139712.1.11494 WP_000139712.1.11504 WP_000139712.1.11525 WP_000139712.1.11556 WP_000139712.1.11558 WP_000139712.1.11571 WP_000139712.1.11592 WP_000139712.1.11611 WP_000139712.1.11625 WP_000139712.1.11640 WP_000139712.1.11646 WP_000139712.1.11655 WP_000139712.1.11660 WP_000139712.1.11663 WP_000139712.1.11665 WP_000139712.1.11692 WP_000139712.1.117 WP_000139712.1.1171 WP_000139712.1.11719 WP_000139712.1.11720 WP_000139712.1.11730 WP_000139712.1.11736 WP_000139712.1.11741 WP_000139712.1.11768 WP_000139712.1.11781 WP_000139712.1.11794 WP_000139712.1.11795 WP_000139712.1.11816 WP_000139712.1.11829 WP_000139712.1.11837 WP_000139712.1.11884 WP_000139712.1.11903 WP_000139712.1.11919 WP_000139712.1.11991 WP_000139712.1.12005 WP_000139712.1.12019 WP_000139712.1.12042 WP_000139712.1.1205 WP_000139712.1.12073 WP_000139712.1.12098 WP_000139712.1.1210 WP_000139712.1.12123 WP_000139712.1.12137 WP_000139712.1.12149 WP_000139712.1.12152 WP_000139712.1.12170 WP_000139712.1.12175 WP_000139712.1.12179 WP_000139712.1.12181 WP_000139712.1.12194 WP_000139712.1.12226 WP_000139712.1.12233 WP_000139712.1.12234 WP_000139712.1.12256 WP_000139712.1.12272 WP_000139712.1.12297 WP_000139712.1.12328 WP_000139712.1.12330 WP_000139712.1.12361 WP_000139712.1.12366 WP_000139712.1.12391 WP_000139712.1.12436 WP_000139712.1.12437 WP_000139712.1.12447 WP_000139712.1.12498 WP_000139712.1.12508 WP_000139712.1.1252 WP_000139712.1.1257 WP_000139712.1.12598 WP_000139712.1.12605 WP_000139712.1.12608 WP_000139712.1.12618 WP_000139712.1.12639 WP_000139712.1.12668 WP_000139712.1.12685 WP_000139712.1.12705 WP_000139712.1.12707 WP_000139712.1.12715 WP_000139712.1.12733 WP_000139712.1.12737 WP_000139712.1.12770 WP_000139712.1.12771 WP_000139712.1.12780 WP_000139712.1.12788 WP_000139712.1.12802 WP_000139712.1.12822 WP_000139712.1.12829 WP_000139712.1.12833 WP_000139712.1.12845 WP_000139712.1.12858 WP_000139712.1.12862 WP_000139712.1.12884 WP_000139712.1.12903 WP_000139712.1.12904 WP_000139712.1.12918 WP_000139712.1.12920 WP_000139712.1.12937 WP_000139712.1.12938 WP_000139712.1.12951 WP_000139712.1.12977 WP_000139712.1.13013 WP_000139712.1.13039 WP_000139712.1.13062 WP_000139712.1.13072 WP_000139712.1.13091 WP_000139712.1.13104 WP_000139712.1.13112 WP_000139712.1.13154 WP_000139712.1.13164 WP_000139712.1.13169 WP_000139712.1.13170 WP_000139712.1.13189 WP_000139712.1.13228 WP_000139712.1.13243 WP_000139712.1.13250 WP_000139712.1.13303 WP_000139712.1.13317 WP_000139712.1.13322 WP_000139712.1.13326 WP_000139712.1.13355 WP_000139712.1.13366 WP_000139712.1.13376 WP_000139712.1.13379 WP_000139712.1.13405 WP_000139712.1.13448 WP_000139712.1.13468 WP_000139712.1.1347 WP_000139712.1.13486 WP_000139712.1.13514 WP_000139712.1.13531 WP_000139712.1.1355 WP_000139712.1.13554 WP_000139712.1.13556 WP_000139712.1.13568 WP_000139712.1.13598 WP_000139712.1.13612 WP_000139712.1.13617 WP_000139712.1.13650 WP_000139712.1.13654 WP_000139712.1.13665 WP_000139712.1.13668 WP_000139712.1.13670 WP_000139712.1.13679 WP_000139712.1.13680 WP_000139712.1.13683 WP_000139712.1.13726 WP_000139712.1.13727 WP_000139712.1.13728 WP_000139712.1.13733 WP_000139712.1.1374 WP_000139712.1.13755 WP_000139712.1.13757 WP_000139712.1.13769 WP_000139712.1.13772 WP_000139712.1.13787 WP_000139712.1.13804 WP_000139712.1.13805 WP_000139712.1.13870 WP_000139712.1.13879 WP_000139712.1.13884 WP_000139712.1.13897 WP_000139712.1.13914 WP_000139712.1.13933 WP_000139712.1.13940 WP_000139712.1.13948 WP_000139712.1.13983 WP_000139712.1.13986 WP_000139712.1.13987 WP_000139712.1.14010 WP_000139712.1.14025 WP_000139712.1.14071 WP_000139712.1.14076 WP_000139712.1.14097 WP_000139712.1.14112 WP_000139712.1.14143 WP_000139712.1.14153 WP_000139712.1.14163 WP_000139712.1.1418 WP_000139712.1.1420 WP_000139712.1.14201 WP_000139712.1.14233 WP_000139712.1.1425 WP_000139712.1.1426 WP_000139712.1.14281 WP_000139712.1.1429 WP_000139712.1.14298 WP_000139712.1.14305 WP_000139712.1.14337 WP_000139712.1.14342 WP_000139712.1.14349 WP_000139712.1.14358 WP_000139712.1.14363 WP_000139712.1.14364 WP_000139712.1.14365 WP_000139712.1.14366 WP_000139712.1.14394 WP_000139712.1.14397 WP_000139712.1.14412 WP_000139712.1.14418 WP_000139712.1.14475 WP_000139712.1.14535 WP_000139712.1.1457 WP_000139712.1.14577 WP_000139712.1.14590 WP_000139712.1.14596 WP_000139712.1.14639 WP_000139712.1.14665 WP_000139712.1.14666 WP_000139712.1.1468 WP_000139712.1.14681 WP_000139712.1.14696 WP_000139712.1.147 WP_000139712.1.1471 WP_000139712.1.14729 WP_000139712.1.14734 WP_000139712.1.14744 WP_000139712.1.14747 WP_000139712.1.1477 WP_000139712.1.14770 WP_000139712.1.14774 WP_000139712.1.14782 WP_000139712.1.14790 WP_000139712.1.14809 WP_000139712.1.14825 WP_000139712.1.14846 WP_000139712.1.14868 WP_000139712.1.14869 WP_000139712.1.14874 WP_000139712.1.14902 WP_000139712.1.14924 WP_000139712.1.14967 WP_000139712.1.14970 WP_000139712.1.14987 WP_000139712.1.15000 WP_000139712.1.15015 WP_000139712.1.15029 WP_000139712.1.15071 WP_000139712.1.15091 WP_000139712.1.15098 WP_000139712.1.15108 WP_000139712.1.15150 WP_000139712.1.15173 WP_000139712.1.15185 WP_000139712.1.1520 WP_000139712.1.15201 WP_000139712.1.15206 WP_000139712.1.15228 WP_000139712.1.15241 WP_000139712.1.1525 WP_000139712.1.15255 WP_000139712.1.15263 WP_000139712.1.15268 WP_000139712.1.15269 WP_000139712.1.15278 WP_000139712.1.15294 WP_000139712.1.15296 WP_000139712.1.15329 WP_000139712.1.15389 WP_000139712.1.15399 WP_000139712.1.15403 WP_000139712.1.15409 WP_000139712.1.15421 WP_000139712.1.15438 WP_000139712.1.1545 WP_000139712.1.15478 WP_000139712.1.15489 WP_000139712.1.15505 WP_000139712.1.15507 WP_000139712.1.15532 WP_000139712.1.15533 WP_000139712.1.15544 WP_000139712.1.15546 WP_000139712.1.15572 WP_000139712.1.1558 WP_000139712.1.15590 WP_000139712.1.15591 WP_000139712.1.1564 WP_000139712.1.15679 WP_000139712.1.15687 WP_000139712.1.1569 WP_000139712.1.15691 WP_000139712.1.15706 WP_000139712.1.15722 WP_000139712.1.15753 WP_000139712.1.15785 WP_000139712.1.1579 WP_000139712.1.15812 WP_000139712.1.15818 WP_000139712.1.15819 WP_000139712.1.1583 WP_000139712.1.15838 WP_000139712.1.15883 WP_000139712.1.15888 WP_000139712.1.15892 WP_000139712.1.15897 WP_000139712.1.15898 WP_000139712.1.159 WP_000139712.1.15920 WP_000139712.1.15921 WP_000139712.1.15925 WP_000139712.1.15928 WP_000139712.1.15939 WP_000139712.1.15948 WP_000139712.1.15957 WP_000139712.1.15972 WP_000139712.1.1600 WP_000139712.1.16018 WP_000139712.1.1606 WP_000139712.1.16068 WP_000139712.1.16096 WP_000139712.1.16098 WP_000139712.1.16112 WP_000139712.1.16114 WP_000139712.1.16140 WP_000139712.1.16157 WP_000139712.1.16173 WP_000139712.1.16195 WP_000139712.1.16203 WP_000139712.1.16213 WP_000139712.1.16223 WP_000139712.1.1623 WP_000139712.1.16237 WP_000139712.1.16251 WP_000139712.1.16265 WP_000139712.1.16276 WP_000139712.1.16311 WP_000139712.1.16362 WP_000139712.1.16395 WP_000139712.1.16399 WP_000139712.1.16407 WP_000139712.1.16436 WP_000139712.1.16455 WP_000139712.1.16458 WP_000139712.1.16467 WP_000139712.1.16478 WP_000139712.1.16554 WP_000139712.1.16569 WP_000139712.1.16589 WP_000139712.1.16603 WP_000139712.1.16617 WP_000139712.1.16628 WP_000139712.1.16632 WP_000139712.1.16639 WP_000139712.1.1665 WP_000139712.1.16651 WP_000139712.1.16653 WP_000139712.1.16672 WP_000139712.1.16679 WP_000139712.1.16688 WP_000139712.1.16693 WP_000139712.1.16703 WP_000139712.1.16747 WP_000139712.1.16757 WP_000139712.1.16761 WP_000139712.1.16768 WP_000139712.1.16770 WP_000139712.1.16794 WP_000139712.1.16815 WP_000139712.1.16824 WP_000139712.1.16880 WP_000139712.1.16882 WP_000139712.1.16892 WP_000139712.1.16920 WP_000139712.1.16925 WP_000139712.1.16946 WP_000139712.1.16969 WP_000139712.1.16986 WP_000139712.1.170 WP_000139712.1.17009 WP_000139712.1.17012 WP_000139712.1.17038 WP_000139712.1.17046 WP_000139712.1.17050 WP_000139712.1.17080 WP_000139712.1.17104 WP_000139712.1.17122 WP_000139712.1.17132 WP_000139712.1.17137 WP_000139712.1.17139 WP_000139712.1.17143 WP_000139712.1.17156 WP_000139712.1.17157 WP_000139712.1.17169 WP_000139712.1.17176 WP_000139712.1.17180 WP_000139712.1.17201 WP_000139712.1.17210 WP_000139712.1.17231 WP_000139712.1.17234 WP_000139712.1.17240 WP_000139712.1.17249 WP_000139712.1.1725 WP_000139712.1.17256 WP_000139712.1.17289 WP_000139712.1.1729 WP_000139712.1.17309 WP_000139712.1.17320 WP_000139712.1.17327 WP_000139712.1.1736 WP_000139712.1.1740 WP_000139712.1.1741 WP_000139712.1.17419 WP_000139712.1.17450 WP_000139712.1.17454 WP_000139712.1.17485 WP_000139712.1.17520 WP_000139712.1.17529 WP_000139712.1.17531 WP_000139712.1.1756 WP_000139712.1.17569 WP_000139712.1.17581 WP_000139712.1.17590 WP_000139712.1.17643 WP_000139712.1.1765 WP_000139712.1.17650 WP_000139712.1.17657 WP_000139712.1.17666 WP_000139712.1.17671 WP_000139712.1.17676 WP_000139712.1.17717 WP_000139712.1.17718 WP_000139712.1.17725 WP_000139712.1.17729 WP_000139712.1.17737 WP_000139712.1.17770 WP_000139712.1.17796 WP_000139712.1.17832 WP_000139712.1.17834 WP_000139712.1.17845 WP_000139712.1.17847 WP_000139712.1.17853 WP_000139712.1.17859 WP_000139712.1.17876 WP_000139712.1.17909 WP_000139712.1.17922 WP_000139712.1.17928 WP_000139712.1.17943 WP_000139712.1.17951 WP_000139712.1.17974 WP_000139712.1.17987 WP_000139712.1.18011 WP_000139712.1.18016 WP_000139712.1.18035 WP_000139712.1.18043 WP_000139712.1.18069 WP_000139712.1.18074 WP_000139712.1.18080 WP_000139712.1.18105 WP_000139712.1.18113 WP_000139712.1.18140 WP_000139712.1.18153 WP_000139712.1.18197 WP_000139712.1.18203 WP_000139712.1.18205 WP_000139712.1.18237 WP_000139712.1.18248 WP_000139712.1.18261 WP_000139712.1.18273 WP_000139712.1.18283 WP_000139712.1.18288 WP_000139712.1.1829 WP_000139712.1.18290 WP_000139712.1.18301 WP_000139712.1.18309 WP_000139712.1.18310 WP_000139712.1.18320 WP_000139712.1.18346 WP_000139712.1.1835 WP_000139712.1.18360 WP_000139712.1.18412 WP_000139712.1.18429 WP_000139712.1.18437 WP_000139712.1.18451 WP_000139712.1.1847 WP_000139712.1.18487 WP_000139712.1.18495 WP_000139712.1.185 WP_000139712.1.18506 WP_000139712.1.18507 WP_000139712.1.1851 WP_000139712.1.18516 WP_000139712.1.18527 WP_000139712.1.18529 WP_000139712.1.18538 WP_000139712.1.18539 WP_000139712.1.18560 WP_000139712.1.18562 WP_000139712.1.18567 WP_000139712.1.18570 WP_000139712.1.18590 WP_000139712.1.18591 WP_000139712.1.18611 WP_000139712.1.18627 WP_000139712.1.18632 WP_000139712.1.18656 WP_000139712.1.18658 WP_000139712.1.18668 WP_000139712.1.18679 WP_000139712.1.18719 WP_000139712.1.18741 WP_000139712.1.18758 WP_000139712.1.18777 WP_000139712.1.18792 WP_000139712.1.18809 WP_000139712.1.18818 WP_000139712.1.18819 WP_000139712.1.18830 WP_000139712.1.18834 WP_000139712.1.18836 WP_000139712.1.18879 WP_000139712.1.18882 WP_000139712.1.18918 WP_000139712.1.1892 WP_000139712.1.18938 WP_000139712.1.18963 WP_000139712.1.18965 WP_000139712.1.18968 WP_000139712.1.18974 WP_000139712.1.18987 WP_000139712.1.18996 WP_000139712.1.19009 WP_000139712.1.1901 WP_000139712.1.19014 WP_000139712.1.19022 WP_000139712.1.19027 WP_000139712.1.19052 WP_000139712.1.19082 WP_000139712.1.19102 WP_000139712.1.19109 WP_000139712.1.1911 WP_000139712.1.19149 WP_000139712.1.19179 WP_000139712.1.192 WP_000139712.1.1921 WP_000139712.1.19259 WP_000139712.1.19272 WP_000139712.1.19301 WP_000139712.1.19306 WP_000139712.1.19322 WP_000139712.1.19375 WP_000139712.1.19377 WP_000139712.1.19390 WP_000139712.1.19399 WP_000139712.1.19411 WP_000139712.1.1943 WP_000139712.1.19430 WP_000139712.1.19444 WP_000139712.1.19450 WP_000139712.1.19509 WP_000139712.1.19537 WP_000139712.1.19555 WP_000139712.1.19575 WP_000139712.1.19577 WP_000139712.1.19611 WP_000139712.1.1962 WP_000139712.1.1964 WP_000139712.1.19643 WP_000139712.1.19653 WP_000139712.1.19700 WP_000139712.1.19701 WP_000139712.1.19725 WP_000139712.1.19732 WP_000139712.1.19733 WP_000139712.1.1974 WP_000139712.1.19748 WP_000139712.1.1975 WP_000139712.1.19759 WP_000139712.1.19765 WP_000139712.1.19775 WP_000139712.1.19788 WP_000139712.1.19792 WP_000139712.1.19807 WP_000139712.1.19816 WP_000139712.1.19848 WP_000139712.1.19853 WP_000139712.1.19881 WP_000139712.1.19891 WP_000139712.1.19912 WP_000139712.1.19921 WP_000139712.1.19980 WP_000139712.1.19981 WP_000139712.1.19982 WP_000139712.1.2 WP_000139712.1.20049 WP_000139712.1.20052 WP_000139712.1.20057 WP_000139712.1.2007 WP_000139712.1.20078 WP_000139712.1.2008 WP_000139712.1.20090 WP_000139712.1.20100 WP_000139712.1.20101 WP_000139712.1.2013 WP_000139712.1.20155 WP_000139712.1.20156 WP_000139712.1.20160 WP_000139712.1.20161 WP_000139712.1.20167 WP_000139712.1.20177 WP_000139712.1.20191 WP_000139712.1.20210 WP_000139712.1.20235 WP_000139712.1.20265 WP_000139712.1.2029 WP_000139712.1.20324 WP_000139712.1.20340 WP_000139712.1.20354 WP_000139712.1.20386 WP_000139712.1.20394 WP_000139712.1.20398 WP_000139712.1.20399 WP_000139712.1.20411 WP_000139712.1.20447 WP_000139712.1.20473 WP_000139712.1.20479 WP_000139712.1.20487 WP_000139712.1.20500 WP_000139712.1.20554 WP_000139712.1.20558 WP_000139712.1.20574 WP_000139712.1.20579 WP_000139712.1.20585 WP_000139712.1.20611 WP_000139712.1.20619 WP_000139712.1.20620 WP_000139712.1.20649 WP_000139712.1.20661 WP_000139712.1.20690 WP_000139712.1.20698 WP_000139712.1.20736 WP_000139712.1.20772 WP_000139712.1.20796 WP_000139712.1.20821 WP_000139712.1.20833 WP_000139712.1.20838 WP_000139712.1.20846 WP_000139712.1.20860 WP_000139712.1.20867 WP_000139712.1.20878 WP_000139712.1.20913 WP_000139712.1.20922 WP_000139712.1.20935 WP_000139712.1.20939 WP_000139712.1.20945 WP_000139712.1.20971 WP_000139712.1.20975 WP_000139712.1.20979 WP_000139712.1.21009 WP_000139712.1.21013 WP_000139712.1.21031 WP_000139712.1.21054 WP_000139712.1.21056 WP_000139712.1.21064 WP_000139712.1.21066 WP_000139712.1.21078 WP_000139712.1.21080 WP_000139712.1.21081 WP_000139712.1.21102 WP_000139712.1.21109 WP_000139712.1.21111 WP_000139712.1.21154 WP_000139712.1.21183 WP_000139712.1.2119 WP_000139712.1.21257 WP_000139712.1.21272 WP_000139712.1.2128 WP_000139712.1.2129 WP_000139712.1.21312 WP_000139712.1.21330 WP_000139712.1.21339 WP_000139712.1.2135 WP_000139712.1.21356 WP_000139712.1.21359 WP_000139712.1.21379 WP_000139712.1.21386 WP_000139712.1.21393 WP_000139712.1.21402 WP_000139712.1.21412 WP_000139712.1.21449 WP_000139712.1.21458 WP_000139712.1.21464 WP_000139712.1.21465 WP_000139712.1.21480 WP_000139712.1.21500 WP_000139712.1.21511 WP_000139712.1.21514 WP_000139712.1.2154 WP_000139712.1.21572 WP_000139712.1.21583 WP_000139712.1.2159 WP_000139712.1.2160 WP_000139712.1.21601 WP_000139712.1.21621 WP_000139712.1.21636 WP_000139712.1.21679 WP_000139712.1.21712 WP_000139712.1.21724 WP_000139712.1.21746 WP_000139712.1.21763 WP_000139712.1.2178 WP_000139712.1.21787 WP_000139712.1.21820 WP_000139712.1.21830 WP_000139712.1.21890 WP_000139712.1.21894 WP_000139712.1.21901 WP_000139712.1.21954 WP_000139712.1.21988 WP_000139712.1.22022 WP_000139712.1.22027 WP_000139712.1.22045 WP_000139712.1.22065 WP_000139712.1.22082 WP_000139712.1.22093 WP_000139712.1.2211 WP_000139712.1.22111 WP_000139712.1.22149 WP_000139712.1.22163 WP_000139712.1.22165 WP_000139712.1.22170 WP_000139712.1.22174 WP_000139712.1.22177 WP_000139712.1.22180 WP_000139712.1.22197 WP_000139712.1.22200 WP_000139712.1.22227 WP_000139712.1.22246 WP_000139712.1.22259 WP_000139712.1.22302 WP_000139712.1.22307 WP_000139712.1.22332 WP_000139712.1.22344 WP_000139712.1.22351 WP_000139712.1.22367 WP_000139712.1.22369 WP_000139712.1.22400 WP_000139712.1.22418 WP_000139712.1.22493 WP_000139712.1.22526 WP_000139712.1.22531 WP_000139712.1.22533 WP_000139712.1.22547 WP_000139712.1.22551 WP_000139712.1.22559 WP_000139712.1.22650 WP_000139712.1.22657 WP_000139712.1.22696 WP_000139712.1.22702 WP_000139712.1.22709 WP_000139712.1.22714 WP_000139712.1.22727 WP_000139712.1.22730 WP_000139712.1.22731 WP_000139712.1.22738 WP_000139712.1.22739 WP_000139712.1.22789 WP_000139712.1.22790 WP_000139712.1.22792 WP_000139712.1.2280 WP_000139712.1.22803 WP_000139712.1.22808 WP_000139712.1.22811 WP_000139712.1.22843 WP_000139712.1.22853 WP_000139712.1.22859 WP_000139712.1.22861 WP_000139712.1.22869 WP_000139712.1.22924 WP_000139712.1.22969 WP_000139712.1.22975 WP_000139712.1.22994 WP_000139712.1.23004 WP_000139712.1.23008 WP_000139712.1.23048 WP_000139712.1.23061 WP_000139712.1.23069 WP_000139712.1.23082 WP_000139712.1.23103 WP_000139712.1.23121 WP_000139712.1.23130 WP_000139712.1.23132 WP_000139712.1.23133 WP_000139712.1.23152 WP_000139712.1.23161 WP_000139712.1.23185 WP_000139712.1.23194 WP_000139712.1.23197 WP_000139712.1.23217 WP_000139712.1.23222 WP_000139712.1.23228 WP_000139712.1.23238 WP_000139712.1.23244 WP_000139712.1.2327 WP_000139712.1.23275 WP_000139712.1.23288 WP_000139712.1.23381 WP_000139712.1.23413 WP_000139712.1.23420 WP_000139712.1.23431 WP_000139712.1.23439 WP_000139712.1.23449 WP_000139712.1.23450 WP_000139712.1.23489 WP_000139712.1.23491 WP_000139712.1.23516 WP_000139712.1.23531 WP_000139712.1.23541 WP_000139712.1.23544 WP_000139712.1.23568 WP_000139712.1.23572 WP_000139712.1.23580 WP_000139712.1.23586 WP_000139712.1.23613 WP_000139712.1.23617 WP_000139712.1.23626 WP_000139712.1.23630 WP_000139712.1.23644 WP_000139712.1.2365 WP_000139712.1.23690 WP_000139712.1.23740 WP_000139712.1.23796 WP_000139712.1.23809 WP_000139712.1.2382 WP_000139712.1.23822 WP_000139712.1.23842 WP_000139712.1.23849 WP_000139712.1.23856 WP_000139712.1.2389 WP_000139712.1.23896 WP_000139712.1.23900 WP_000139712.1.23902 WP_000139712.1.23907 WP_000139712.1.23935 WP_000139712.1.23944 WP_000139712.1.23956 WP_000139712.1.23972 WP_000139712.1.23995 WP_000139712.1.23998 WP_000139712.1.24000 WP_000139712.1.24129 WP_000139712.1.24148 WP_000139712.1.24167 WP_000139712.1.24174 WP_000139712.1.2420 WP_000139712.1.24207 WP_000139712.1.24213 WP_000139712.1.2423 WP_000139712.1.24241 WP_000139712.1.24263 WP_000139712.1.2427 WP_000139712.1.24275 WP_000139712.1.24277 WP_000139712.1.24279 WP_000139712.1.2434 WP_000139712.1.24343 WP_000139712.1.24364 WP_000139712.1.24416 WP_000139712.1.24418 WP_000139712.1.2442 WP_000139712.1.24436 WP_000139712.1.24437 WP_000139712.1.24439 WP_000139712.1.24443 WP_000139712.1.24462 WP_000139712.1.24469 WP_000139712.1.24478 WP_000139712.1.2450 WP_000139712.1.24503 WP_000139712.1.24519 WP_000139712.1.2458 WP_000139712.1.24589 WP_000139712.1.24596 WP_000139712.1.24602 WP_000139712.1.24617 WP_000139712.1.24631 WP_000139712.1.24679 WP_000139712.1.24681 WP_000139712.1.24684 WP_000139712.1.24685 WP_000139712.1.24702 WP_000139712.1.24745 WP_000139712.1.24781 WP_000139712.1.2480 WP_000139712.1.24802 WP_000139712.1.24823 WP_000139712.1.24855 WP_000139712.1.24891 WP_000139712.1.24903 WP_000139712.1.24918 WP_000139712.1.2497 WP_000139712.1.25007 WP_000139712.1.2501 WP_000139712.1.25012 WP_000139712.1.25029 WP_000139712.1.2506 WP_000139712.1.25070 WP_000139712.1.25083 WP_000139712.1.25092 WP_000139712.1.25095 WP_000139712.1.25098 WP_000139712.1.25115 WP_000139712.1.25120 WP_000139712.1.25145 WP_000139712.1.25167 WP_000139712.1.25170 WP_000139712.1.25209 WP_000139712.1.2522 WP_000139712.1.25262 WP_000139712.1.25287 WP_000139712.1.25331 WP_000139712.1.25361 WP_000139712.1.25433 WP_000139712.1.25438 WP_000139712.1.2544 WP_000139712.1.25459 WP_000139712.1.25469 WP_000139712.1.25479 WP_000139712.1.25489 WP_000139712.1.25511 WP_000139712.1.2552 WP_000139712.1.25557 WP_000139712.1.25567 WP_000139712.1.25593 WP_000139712.1.25595 WP_000139712.1.25621 WP_000139712.1.25623 WP_000139712.1.25633 WP_000139712.1.25634 WP_000139712.1.257 WP_000139712.1.25721 WP_000139712.1.25737 WP_000139712.1.25758 WP_000139712.1.25770 WP_000139712.1.25772 WP_000139712.1.25776 WP_000139712.1.25779 WP_000139712.1.2579 WP_000139712.1.25801 WP_000139712.1.25802 WP_000139712.1.25820 WP_000139712.1.25840 WP_000139712.1.25852 WP_000139712.1.25856 WP_000139712.1.25857 WP_000139712.1.25867 WP_000139712.1.25868 WP_000139712.1.25881 WP_000139712.1.25891 WP_000139712.1.2590 WP_000139712.1.25910 WP_000139712.1.2592 WP_000139712.1.25924 WP_000139712.1.2593 WP_000139712.1.25930 WP_000139712.1.25955 WP_000139712.1.25984 WP_000139712.1.26006 WP_000139712.1.26012 WP_000139712.1.26015 WP_000139712.1.26033 WP_000139712.1.26039 WP_000139712.1.2608 WP_000139712.1.26086 WP_000139712.1.26106 WP_000139712.1.26143 WP_000139712.1.26169 WP_000139712.1.26172 WP_000139712.1.2619 WP_000139712.1.262 WP_000139712.1.2621 WP_000139712.1.26226 WP_000139712.1.26255 WP_000139712.1.26266 WP_000139712.1.26276 WP_000139712.1.26289 WP_000139712.1.26290 WP_000139712.1.26293 WP_000139712.1.26298 WP_000139712.1.26306 WP_000139712.1.26307 WP_000139712.1.26314 WP_000139712.1.26318 WP_000139712.1.2633 WP_000139712.1.26340 WP_000139712.1.26345 WP_000139712.1.26346 WP_000139712.1.26354 WP_000139712.1.26359 WP_000139712.1.26364 WP_000139712.1.26370 WP_000139712.1.26397 WP_000139712.1.26399 WP_000139712.1.26404 WP_000139712.1.26405 WP_000139712.1.2643 WP_000139712.1.2645 WP_000139712.1.26481 WP_000139712.1.26506 WP_000139712.1.26555 WP_000139712.1.2656 WP_000139712.1.2658 WP_000139712.1.26584 WP_000139712.1.2661 WP_000139712.1.26626 WP_000139712.1.2664 WP_000139712.1.26662 WP_000139712.1.26663 WP_000139712.1.26677 WP_000139712.1.26692 WP_000139712.1.26713 WP_000139712.1.26726 WP_000139712.1.2673 WP_000139712.1.26733 WP_000139712.1.2674 WP_000139712.1.26749 WP_000139712.1.26751 WP_000139712.1.26771 WP_000139712.1.26772 WP_000139712.1.26790 WP_000139712.1.26804 WP_000139712.1.2684 WP_000139712.1.26840 WP_000139712.1.26850 WP_000139712.1.26865 WP_000139712.1.2687 WP_000139712.1.26884 WP_000139712.1.2689 WP_000139712.1.26903 WP_000139712.1.26905 WP_000139712.1.26927 WP_000139712.1.26929 WP_000139712.1.26938 WP_000139712.1.26944 WP_000139712.1.26958 WP_000139712.1.26963 WP_000139712.1.2697 WP_000139712.1.27013 WP_000139712.1.27042 WP_000139712.1.27053 WP_000139712.1.27080 WP_000139712.1.27083 WP_000139712.1.27154 WP_000139712.1.27166 WP_000139712.1.27168 WP_000139712.1.27170 WP_000139712.1.2718 WP_000139712.1.27182 WP_000139712.1.2719 WP_000139712.1.27199 WP_000139712.1.27207 WP_000139712.1.27237 WP_000139712.1.27246 WP_000139712.1.2725 WP_000139712.1.27262 WP_000139712.1.27293 WP_000139712.1.27294 WP_000139712.1.27311 WP_000139712.1.27323 WP_000139712.1.27333 WP_000139712.1.2734 WP_000139712.1.27345 WP_000139712.1.27379 WP_000139712.1.27387 WP_000139712.1.27447 WP_000139712.1.27448 WP_000139712.1.27455 WP_000139712.1.27456 WP_000139712.1.27457 WP_000139712.1.27467 WP_000139712.1.27468 WP_000139712.1.2753 WP_000139712.1.27539 WP_000139712.1.27551 WP_000139712.1.27562 WP_000139712.1.2759 WP_000139712.1.27590 WP_000139712.1.27608 WP_000139712.1.27614 WP_000139712.1.27615 WP_000139712.1.27621 WP_000139712.1.27628 WP_000139712.1.27640 WP_000139712.1.27646 WP_000139712.1.27654 WP_000139712.1.27670 WP_000139712.1.2768 WP_000139712.1.27689 WP_000139712.1.27696 WP_000139712.1.27717 WP_000139712.1.27739 WP_000139712.1.27744 WP_000139712.1.27748 WP_000139712.1.27765 WP_000139712.1.27793 WP_000139712.1.27799 WP_000139712.1.27817 WP_000139712.1.27830 WP_000139712.1.27834 WP_000139712.1.27854 WP_000139712.1.27929 WP_000139712.1.2795 WP_000139712.1.27950 WP_000139712.1.27953 WP_000139712.1.27972 WP_000139712.1.28007 WP_000139712.1.28016 WP_000139712.1.28025 WP_000139712.1.28063 WP_000139712.1.28071 WP_000139712.1.28079 WP_000139712.1.28081 WP_000139712.1.28088 WP_000139712.1.28091 WP_000139712.1.28105 WP_000139712.1.28117 WP_000139712.1.28138 WP_000139712.1.28147 WP_000139712.1.28158 WP_000139712.1.28173 WP_000139712.1.28191 WP_000139712.1.28207 WP_000139712.1.28213 WP_000139712.1.28226 WP_000139712.1.28230 WP_000139712.1.28253 WP_000139712.1.28257 WP_000139712.1.28274 WP_000139712.1.28315 WP_000139712.1.28319 WP_000139712.1.28347 WP_000139712.1.28358 WP_000139712.1.28360 WP_000139712.1.28376 WP_000139712.1.28381 WP_000139712.1.28399 WP_000139712.1.28400 WP_000139712.1.28426 WP_000139712.1.28430 WP_000139712.1.28447 WP_000139712.1.28477 WP_000139712.1.28482 WP_000139712.1.28498 WP_000139712.1.28501 WP_000139712.1.28502 WP_000139712.1.2852 WP_000139712.1.28527 WP_000139712.1.28532 WP_000139712.1.28564 WP_000139712.1.28578 WP_000139712.1.28580 WP_000139712.1.28584 WP_000139712.1.28605 WP_000139712.1.28614 WP_000139712.1.2862 WP_000139712.1.28629 WP_000139712.1.28650 WP_000139712.1.28652 WP_000139712.1.28672 WP_000139712.1.28675 WP_000139712.1.28690 WP_000139712.1.28710 WP_000139712.1.28720 WP_000139712.1.28725 WP_000139712.1.28763 WP_000139712.1.28784 WP_000139712.1.28785 WP_000139712.1.28848 WP_000139712.1.28862 WP_000139712.1.28866 WP_000139712.1.28871 WP_000139712.1.28887 WP_000139712.1.28909 WP_000139712.1.2891 WP_000139712.1.28915 WP_000139712.1.28933 WP_000139712.1.28960 WP_000139712.1.28970 WP_000139712.1.28981 WP_000139712.1.28987 WP_000139712.1.29014 WP_000139712.1.29052 WP_000139712.1.29060 WP_000139712.1.29090 WP_000139712.1.29107 WP_000139712.1.29112 WP_000139712.1.2913 WP_000139712.1.29155 WP_000139712.1.29166 WP_000139712.1.29187 WP_000139712.1.29188 WP_000139712.1.29207 WP_000139712.1.29226 WP_000139712.1.29242 WP_000139712.1.29243 WP_000139712.1.29244 WP_000139712.1.29263 WP_000139712.1.29272 WP_000139712.1.29276 WP_000139712.1.29282 WP_000139712.1.29285 WP_000139712.1.29301 WP_000139712.1.29312 WP_000139712.1.29315 WP_000139712.1.29329 WP_000139712.1.29366 WP_000139712.1.29368 WP_000139712.1.29372 WP_000139712.1.29373 WP_000139712.1.29381 WP_000139712.1.29395 WP_000139712.1.29420 WP_000139712.1.29445 WP_000139712.1.29468 WP_000139712.1.29511 WP_000139712.1.29522 WP_000139712.1.29541 WP_000139712.1.29553 WP_000139712.1.29554 WP_000139712.1.29561 WP_000139712.1.2957 WP_000139712.1.29596 WP_000139712.1.29644 WP_000139712.1.29676 WP_000139712.1.29716 WP_000139712.1.2972 WP_000139712.1.29731 WP_000139712.1.29736 WP_000139712.1.29744 WP_000139712.1.2975 WP_000139712.1.29758 WP_000139712.1.29781 WP_000139712.1.29788 WP_000139712.1.29805 WP_000139712.1.2981 WP_000139712.1.29826 WP_000139712.1.2983 WP_000139712.1.29862 WP_000139712.1.29885 WP_000139712.1.29902 WP_000139712.1.29905 WP_000139712.1.29918 WP_000139712.1.29956 WP_000139712.1.29963 WP_000139712.1.2997 WP_000139712.1.29981 WP_000139712.1.29982 WP_000139712.1.30012 WP_000139712.1.30023 WP_000139712.1.30033 WP_000139712.1.30047 WP_000139712.1.30057 WP_000139712.1.30089 WP_000139712.1.30095 WP_000139712.1.30100 WP_000139712.1.30115 WP_000139712.1.30130 WP_000139712.1.30152 WP_000139712.1.30154 WP_000139712.1.30176 WP_000139712.1.30186 WP_000139712.1.30191 WP_000139712.1.30197 WP_000139712.1.30204 WP_000139712.1.30209 WP_000139712.1.30249 WP_000139712.1.30268 WP_000139712.1.30274 WP_000139712.1.3029 WP_000139712.1.30302 WP_000139712.1.30307 WP_000139712.1.30328 WP_000139712.1.30333 WP_000139712.1.30350 WP_000139712.1.30364 WP_000139712.1.30367 WP_000139712.1.30376 WP_000139712.1.30381 WP_000139712.1.30385 WP_000139712.1.30418 WP_000139712.1.30422 WP_000139712.1.30458 WP_000139712.1.30477 WP_000139712.1.30496 WP_000139712.1.30508 WP_000139712.1.30530 WP_000139712.1.30531 WP_000139712.1.30560 WP_000139712.1.30566 WP_000139712.1.30568 WP_000139712.1.30622 WP_000139712.1.30623 WP_000139712.1.30645 WP_000139712.1.30646 WP_000139712.1.30648 WP_000139712.1.30650 WP_000139712.1.30652 WP_000139712.1.30666 WP_000139712.1.30702 WP_000139712.1.30720 WP_000139712.1.30726 WP_000139712.1.30758 WP_000139712.1.30763 WP_000139712.1.3077 WP_000139712.1.30779 WP_000139712.1.30845 WP_000139712.1.30846 WP_000139712.1.30847 WP_000139712.1.30854 WP_000139712.1.30862 WP_000139712.1.30863 WP_000139712.1.30874 WP_000139712.1.30878 WP_000139712.1.30880 WP_000139712.1.30889 WP_000139712.1.30907 WP_000139712.1.30911 WP_000139712.1.30915 WP_000139712.1.30916 WP_000139712.1.30928 WP_000139712.1.30962 WP_000139712.1.3097 WP_000139712.1.30970 WP_000139712.1.30971 WP_000139712.1.30998 WP_000139712.1.31005 WP_000139712.1.31022 WP_000139712.1.31037 WP_000139712.1.31039 WP_000139712.1.31041 WP_000139712.1.31048 WP_000139712.1.31065 WP_000139712.1.31068 WP_000139712.1.31077 WP_000139712.1.31091 WP_000139712.1.31113 WP_000139712.1.31120 WP_000139712.1.31124 WP_000139712.1.31176 WP_000139712.1.31194 WP_000139712.1.31202 WP_000139712.1.31206 WP_000139712.1.31212 WP_000139712.1.3123 WP_000139712.1.31232 WP_000139712.1.31278 WP_000139712.1.31315 WP_000139712.1.3132 WP_000139712.1.31337 WP_000139712.1.31339 WP_000139712.1.31355 WP_000139712.1.31376 WP_000139712.1.31426 WP_000139712.1.31436 WP_000139712.1.31437 WP_000139712.1.31441 WP_000139712.1.31442 WP_000139712.1.31462 WP_000139712.1.31468 WP_000139712.1.31478 WP_000139712.1.31479 WP_000139712.1.31497 WP_000139712.1.315 WP_000139712.1.31505 WP_000139712.1.31529 WP_000139712.1.31539 WP_000139712.1.31567 WP_000139712.1.31568 WP_000139712.1.31589 WP_000139712.1.31605 WP_000139712.1.31611 WP_000139712.1.31621 WP_000139712.1.31638 WP_000139712.1.31642 WP_000139712.1.31647 WP_000139712.1.31653 WP_000139712.1.31667 WP_000139712.1.31686 WP_000139712.1.31743 WP_000139712.1.31753 WP_000139712.1.31787 WP_000139712.1.31791 WP_000139712.1.31797 WP_000139712.1.31817 WP_000139712.1.31827 WP_000139712.1.31828 WP_000139712.1.31842 WP_000139712.1.3188 WP_000139712.1.31892 WP_000139712.1.31897 WP_000139712.1.31925 WP_000139712.1.31931 WP_000139712.1.31949 WP_000139712.1.31990 WP_000139712.1.31994 WP_000139712.1.31997 WP_000139712.1.32003 WP_000139712.1.32005 WP_000139712.1.32029 WP_000139712.1.32040 WP_000139712.1.32059 WP_000139712.1.32067 WP_000139712.1.32077 WP_000139712.1.32118 WP_000139712.1.32122 WP_000139712.1.32125 WP_000139712.1.32130 WP_000139712.1.32160 WP_000139712.1.32167 WP_000139712.1.32207 WP_000139712.1.32215 WP_000139712.1.32217 WP_000139712.1.32244 WP_000139712.1.32248 WP_000139712.1.32281 WP_000139712.1.3229 WP_000139712.1.32295 WP_000139712.1.3231 WP_000139712.1.32339 WP_000139712.1.32348 WP_000139712.1.32365 WP_000139712.1.32384 WP_000139712.1.32405 WP_000139712.1.3242 WP_000139712.1.3244 WP_000139712.1.32454 WP_000139712.1.32464 WP_000139712.1.32474 WP_000139712.1.32481 WP_000139712.1.32483 WP_000139712.1.32514 WP_000139712.1.32517 WP_000139712.1.32534 WP_000139712.1.32555 WP_000139712.1.32565 WP_000139712.1.32584 WP_000139712.1.32588 WP_000139712.1.32599 WP_000139712.1.32607 WP_000139712.1.32634 WP_000139712.1.32645 WP_000139712.1.32739 WP_000139712.1.32746 WP_000139712.1.32761 WP_000139712.1.32763 WP_000139712.1.32764 WP_000139712.1.32770 WP_000139712.1.32800 WP_000139712.1.32829 WP_000139712.1.32839 WP_000139712.1.32921 WP_000139712.1.32928 WP_000139712.1.3293 WP_000139712.1.32939 WP_000139712.1.32954 WP_000139712.1.32965 WP_000139712.1.32987 WP_000139712.1.3299 WP_000139712.1.33029 WP_000139712.1.33038 WP_000139712.1.33048 WP_000139712.1.3306 WP_000139712.1.33067 WP_000139712.1.33108 WP_000139712.1.33110 WP_000139712.1.33123 WP_000139712.1.33138 WP_000139712.1.33147 WP_000139712.1.33172 WP_000139712.1.33212 WP_000139712.1.33213 WP_000139712.1.33250 WP_000139712.1.33252 WP_000139712.1.33255 WP_000139712.1.33266 WP_000139712.1.33292 WP_000139712.1.33296 WP_000139712.1.3330 WP_000139712.1.33307 WP_000139712.1.33322 WP_000139712.1.33328 WP_000139712.1.33335 WP_000139712.1.3335 WP_000139712.1.33350 WP_000139712.1.33357 WP_000139712.1.33372 WP_000139712.1.3338 WP_000139712.1.33388 WP_000139712.1.33394 WP_000139712.1.3341 WP_000139712.1.33416 WP_000139712.1.3342 WP_000139712.1.33426 WP_000139712.1.3343 WP_000139712.1.33432 WP_000139712.1.33463 WP_000139712.1.33468 WP_000139712.1.3347 WP_000139712.1.33483 WP_000139712.1.33484 WP_000139712.1.33507 WP_000139712.1.33520 WP_000139712.1.33538 WP_000139712.1.33567 WP_000139712.1.33575 WP_000139712.1.33594 WP_000139712.1.33607 WP_000139712.1.33610 WP_000139712.1.33626 WP_000139712.1.33627 WP_000139712.1.3363 WP_000139712.1.33640 WP_000139712.1.33650 WP_000139712.1.33654 WP_000139712.1.33655 WP_000139712.1.33692 WP_000139712.1.33695 WP_000139712.1.33707 WP_000139712.1.33718 WP_000139712.1.33724 WP_000139712.1.33735 WP_000139712.1.33737 WP_000139712.1.33743 WP_000139712.1.33756 WP_000139712.1.33765 WP_000139712.1.33766 WP_000139712.1.33767 WP_000139712.1.33769 WP_000139712.1.33778 WP_000139712.1.33792 WP_000139712.1.33804 WP_000139712.1.33813 WP_000139712.1.33816 WP_000139712.1.33850 WP_000139712.1.33899 WP_000139712.1.33940 WP_000139712.1.33949 WP_000139712.1.33966 WP_000139712.1.33968 WP_000139712.1.33971 WP_000139712.1.33983 WP_000139712.1.33989 WP_000139712.1.33994 WP_000139712.1.34026 WP_000139712.1.34030 WP_000139712.1.34051 WP_000139712.1.34060 WP_000139712.1.34062 WP_000139712.1.34069 WP_000139712.1.34078 WP_000139712.1.34080 WP_000139712.1.34089 WP_000139712.1.34100 WP_000139712.1.34105 WP_000139712.1.34112 WP_000139712.1.34128 WP_000139712.1.34132 WP_000139712.1.34168 WP_000139712.1.3418 WP_000139712.1.34182 WP_000139712.1.34194 WP_000139712.1.34209 WP_000139712.1.34223 WP_000139712.1.34244 WP_000139712.1.34249 WP_000139712.1.34250 WP_000139712.1.34251 WP_000139712.1.34254 WP_000139712.1.34280 WP_000139712.1.34285 WP_000139712.1.34334 WP_000139712.1.34361 WP_000139712.1.34381 WP_000139712.1.34403 WP_000139712.1.34410 WP_000139712.1.3442 WP_000139712.1.34427 WP_000139712.1.34471 WP_000139712.1.34473 WP_000139712.1.3448 WP_000139712.1.34482 WP_000139712.1.34492 WP_000139712.1.34502 WP_000139712.1.34510 WP_000139712.1.34526 WP_000139712.1.34531 WP_000139712.1.34569 WP_000139712.1.3461 WP_000139712.1.34620 WP_000139712.1.34677 WP_000139712.1.34716 WP_000139712.1.34723 WP_000139712.1.34733 WP_000139712.1.34737 WP_000139712.1.3474 WP_000139712.1.34741 WP_000139712.1.34774 WP_000139712.1.34818 WP_000139712.1.34847 WP_000139712.1.34865 WP_000139712.1.34890 WP_000139712.1.34912 WP_000139712.1.34918 WP_000139712.1.34923 WP_000139712.1.34926 WP_000139712.1.34943 WP_000139712.1.34967 WP_000139712.1.34970 WP_000139712.1.34998 WP_000139712.1.35014 WP_000139712.1.35031 WP_000139712.1.35032 WP_000139712.1.35054 WP_000139712.1.35059 WP_000139712.1.35062 WP_000139712.1.35089 WP_000139712.1.35097 WP_000139712.1.35110 WP_000139712.1.35121 WP_000139712.1.35182 WP_000139712.1.35194 WP_000139712.1.35233 WP_000139712.1.35276 WP_000139712.1.35285 WP_000139712.1.35289 WP_000139712.1.35297 WP_000139712.1.35307 WP_000139712.1.35314 WP_000139712.1.35334 WP_000139712.1.35340 WP_000139712.1.35342 WP_000139712.1.35391 WP_000139712.1.354 WP_000139712.1.35413 WP_000139712.1.35415 WP_000139712.1.3542 WP_000139712.1.35423 WP_000139712.1.3547 WP_000139712.1.3549 WP_000139712.1.35498 WP_000139712.1.35506 WP_000139712.1.35508 WP_000139712.1.35517 WP_000139712.1.35525 WP_000139712.1.35549 WP_000139712.1.35580 WP_000139712.1.35615 WP_000139712.1.35623 WP_000139712.1.35642 WP_000139712.1.35659 WP_000139712.1.35661 WP_000139712.1.35673 WP_000139712.1.35686 WP_000139712.1.3569 WP_000139712.1.35696 WP_000139712.1.35730 WP_000139712.1.3574 WP_000139712.1.35742 WP_000139712.1.35746 WP_000139712.1.35784 WP_000139712.1.3579 WP_000139712.1.35801 WP_000139712.1.35837 WP_000139712.1.35888 WP_000139712.1.35890 WP_000139712.1.35900 WP_000139712.1.35903 WP_000139712.1.35928 WP_000139712.1.35958 WP_000139712.1.36004 WP_000139712.1.36041 WP_000139712.1.36082 WP_000139712.1.36093 WP_000139712.1.36102 WP_000139712.1.3611 WP_000139712.1.36119 WP_000139712.1.36141 WP_000139712.1.3617 WP_000139712.1.36176 WP_000139712.1.36179 WP_000139712.1.36187 WP_000139712.1.36188 WP_000139712.1.36208 WP_000139712.1.36211 WP_000139712.1.36249 WP_000139712.1.36250 WP_000139712.1.36264 WP_000139712.1.36278 WP_000139712.1.36282 WP_000139712.1.36302 WP_000139712.1.36307 WP_000139712.1.36344 WP_000139712.1.36389 WP_000139712.1.36430 WP_000139712.1.36434 WP_000139712.1.36439 WP_000139712.1.36532 WP_000139712.1.36535 WP_000139712.1.3655 WP_000139712.1.36570 WP_000139712.1.36580 WP_000139712.1.36600 WP_000139712.1.36615 WP_000139712.1.36640 WP_000139712.1.36646 WP_000139712.1.3666 WP_000139712.1.36669 WP_000139712.1.36689 WP_000139712.1.36697 WP_000139712.1.36698 WP_000139712.1.36704 WP_000139712.1.36729 WP_000139712.1.36745 WP_000139712.1.3675 WP_000139712.1.36754 WP_000139712.1.36773 WP_000139712.1.36783 WP_000139712.1.36793 WP_000139712.1.36796 WP_000139712.1.36797 WP_000139712.1.36814 WP_000139712.1.36822 WP_000139712.1.36823 WP_000139712.1.36847 WP_000139712.1.3685 WP_000139712.1.36858 WP_000139712.1.3687 WP_000139712.1.36888 WP_000139712.1.3690 WP_000139712.1.36903 WP_000139712.1.36911 WP_000139712.1.36916 WP_000139712.1.36932 WP_000139712.1.36952 WP_000139712.1.36955 WP_000139712.1.36962 WP_000139712.1.36979 WP_000139712.1.36980 WP_000139712.1.36983 WP_000139712.1.36997 WP_000139712.1.37002 WP_000139712.1.37016 WP_000139712.1.3703 WP_000139712.1.37044 WP_000139712.1.37045 WP_000139712.1.37053 WP_000139712.1.37055 WP_000139712.1.37075 WP_000139712.1.37080 WP_000139712.1.3709 WP_000139712.1.37120 WP_000139712.1.37121 WP_000139712.1.37130 WP_000139712.1.37134 WP_000139712.1.37135 WP_000139712.1.37145 WP_000139712.1.37159 WP_000139712.1.3718 WP_000139712.1.3719 WP_000139712.1.3722 WP_000139712.1.37220 WP_000139712.1.37240 WP_000139712.1.37335 WP_000139712.1.37341 WP_000139712.1.37378 WP_000139712.1.37398 WP_000139712.1.37408 WP_000139712.1.37411 WP_000139712.1.37424 WP_000139712.1.37435 WP_000139712.1.37453 WP_000139712.1.37467 WP_000139712.1.37503 WP_000139712.1.37546 WP_000139712.1.37583 WP_000139712.1.37602 WP_000139712.1.37605 WP_000139712.1.37606 WP_000139712.1.37621 WP_000139712.1.37624 WP_000139712.1.37644 WP_000139712.1.37669 WP_000139712.1.37679 WP_000139712.1.3774 WP_000139712.1.37749 WP_000139712.1.3776 WP_000139712.1.37764 WP_000139712.1.37771 WP_000139712.1.37781 WP_000139712.1.37788 WP_000139712.1.37815 WP_000139712.1.37828 WP_000139712.1.3784 WP_000139712.1.37851 WP_000139712.1.37855 WP_000139712.1.37866 WP_000139712.1.37875 WP_000139712.1.37891 WP_000139712.1.37906 WP_000139712.1.37907 WP_000139712.1.37929 WP_000139712.1.37953 WP_000139712.1.37987 WP_000139712.1.38020 WP_000139712.1.38030 WP_000139712.1.38034 WP_000139712.1.38038 WP_000139712.1.38057 WP_000139712.1.38070 WP_000139712.1.38082 WP_000139712.1.3809 WP_000139712.1.38100 WP_000139712.1.38111 WP_000139712.1.38128 WP_000139712.1.3813 WP_000139712.1.38136 WP_000139712.1.38160 WP_000139712.1.3817 WP_000139712.1.38177 WP_000139712.1.3820 WP_000139712.1.38212 WP_000139712.1.38222 WP_000139712.1.38230 WP_000139712.1.38232 WP_000139712.1.38276 WP_000139712.1.38282 WP_000139712.1.38304 WP_000139712.1.38309 WP_000139712.1.38316 WP_000139712.1.38339 WP_000139712.1.38383 WP_000139712.1.38390 WP_000139712.1.3842 WP_000139712.1.38422 WP_000139712.1.38435 WP_000139712.1.38437 WP_000139712.1.38453 WP_000139712.1.38493 WP_000139712.1.3850 WP_000139712.1.38516 WP_000139712.1.3852 WP_000139712.1.38522 WP_000139712.1.38546 WP_000139712.1.38555 WP_000139712.1.38557 WP_000139712.1.38607 WP_000139712.1.38612 WP_000139712.1.38658 WP_000139712.1.3867 WP_000139712.1.38674 WP_000139712.1.38688 WP_000139712.1.38721 WP_000139712.1.3875 WP_000139712.1.38760 WP_000139712.1.38786 WP_000139712.1.38823 WP_000139712.1.38841 WP_000139712.1.38858 WP_000139712.1.38862 WP_000139712.1.38875 WP_000139712.1.38885 WP_000139712.1.38890 WP_000139712.1.38926 WP_000139712.1.38927 WP_000139712.1.38931 WP_000139712.1.38940 WP_000139712.1.38941 WP_000139712.1.38943 WP_000139712.1.38960 WP_000139712.1.38972 WP_000139712.1.38979 WP_000139712.1.38985 WP_000139712.1.38989 WP_000139712.1.390 WP_000139712.1.39012 WP_000139712.1.39014 WP_000139712.1.39017 WP_000139712.1.39020 WP_000139712.1.39026 WP_000139712.1.39043 WP_000139712.1.39053 WP_000139712.1.3906 WP_000139712.1.3908 WP_000139712.1.391 WP_000139712.1.39108 WP_000139712.1.39126 WP_000139712.1.39166 WP_000139712.1.39173 WP_000139712.1.39203 WP_000139712.1.39206 WP_000139712.1.39217 WP_000139712.1.39241 WP_000139712.1.3926 WP_000139712.1.39272 WP_000139712.1.39285 WP_000139712.1.39290 WP_000139712.1.39324 WP_000139712.1.39330 WP_000139712.1.39332 WP_000139712.1.39333 WP_000139712.1.39361 WP_000139712.1.39378 WP_000139712.1.39384 WP_000139712.1.39397 WP_000139712.1.39406 WP_000139712.1.39432 WP_000139712.1.39451 WP_000139712.1.39486 WP_000139712.1.39494 WP_000139712.1.39499 WP_000139712.1.39506 WP_000139712.1.39519 WP_000139712.1.39527 WP_000139712.1.39542 WP_000139712.1.39550 WP_000139712.1.39613 WP_000139712.1.39642 WP_000139712.1.39645 WP_000139712.1.39670 WP_000139712.1.39671 WP_000139712.1.39682 WP_000139712.1.39687 WP_000139712.1.39689 WP_000139712.1.39693 WP_000139712.1.39697 WP_000139712.1.39711 WP_000139712.1.39738 WP_000139712.1.39767 WP_000139712.1.39789 WP_000139712.1.39832 WP_000139712.1.39838 WP_000139712.1.39839 WP_000139712.1.39856 WP_000139712.1.39857 WP_000139712.1.39869 WP_000139712.1.39918 WP_000139712.1.39943 WP_000139712.1.39995 WP_000139712.1.40014 WP_000139712.1.40043 WP_000139712.1.40076 WP_000139712.1.40082 WP_000139712.1.40099 WP_000139712.1.4010 WP_000139712.1.40120 WP_000139712.1.40137 WP_000139712.1.40149 WP_000139712.1.4015 WP_000139712.1.40164 WP_000139712.1.40173 WP_000139712.1.4019 WP_000139712.1.40247 WP_000139712.1.40318 WP_000139712.1.40320 WP_000139712.1.40329 WP_000139712.1.40330 WP_000139712.1.40340 WP_000139712.1.40342 WP_000139712.1.40368 WP_000139712.1.40369 WP_000139712.1.40383 WP_000139712.1.40401 WP_000139712.1.40406 WP_000139712.1.40409 WP_000139712.1.40428 WP_000139712.1.4045 WP_000139712.1.40472 WP_000139712.1.40474 WP_000139712.1.40481 WP_000139712.1.40483 WP_000139712.1.40500 WP_000139712.1.40505 WP_000139712.1.40531 WP_000139712.1.40532 WP_000139712.1.40554 WP_000139712.1.4056 WP_000139712.1.4057 WP_000139712.1.40579 WP_000139712.1.40588 WP_000139712.1.40613 WP_000139712.1.40620 WP_000139712.1.40644 WP_000139712.1.40655 WP_000139712.1.40658 WP_000139712.1.40659 WP_000139712.1.40670 WP_000139712.1.40700 WP_000139712.1.40719 WP_000139712.1.40729 WP_000139712.1.40748 WP_000139712.1.40760 WP_000139712.1.4078 WP_000139712.1.40780 WP_000139712.1.40794 WP_000139712.1.40797 WP_000139712.1.40800 WP_000139712.1.40814 WP_000139712.1.40816 WP_000139712.1.40939 WP_000139712.1.40997 WP_000139712.1.41011 WP_000139712.1.4102 WP_000139712.1.41033 WP_000139712.1.41038 WP_000139712.1.4105 WP_000139712.1.41058 WP_000139712.1.41064 WP_000139712.1.41084 WP_000139712.1.41094 WP_000139712.1.41104 WP_000139712.1.41119 WP_000139712.1.41122 WP_000139712.1.41129 WP_000139712.1.41133 WP_000139712.1.4115 WP_000139712.1.41178 WP_000139712.1.412 WP_000139712.1.41208 WP_000139712.1.41241 WP_000139712.1.41255 WP_000139712.1.41289 WP_000139712.1.4129 WP_000139712.1.41350 WP_000139712.1.41374 WP_000139712.1.41386 WP_000139712.1.41389 WP_000139712.1.41411 WP_000139712.1.41426 WP_000139712.1.41432 WP_000139712.1.41433 WP_000139712.1.4144 WP_000139712.1.41448 WP_000139712.1.41458 WP_000139712.1.41473 WP_000139712.1.41499 WP_000139712.1.41511 WP_000139712.1.41532 WP_000139712.1.41533 WP_000139712.1.41555 WP_000139712.1.41558 WP_000139712.1.41567 WP_000139712.1.41581 WP_000139712.1.41582 WP_000139712.1.41587 WP_000139712.1.41598 WP_000139712.1.41612 WP_000139712.1.41620 WP_000139712.1.41623 WP_000139712.1.41647 WP_000139712.1.41674 WP_000139712.1.41681 WP_000139712.1.4169 WP_000139712.1.41726 WP_000139712.1.41743 WP_000139712.1.41755 WP_000139712.1.41770 WP_000139712.1.41796 WP_000139712.1.41817 WP_000139712.1.4182 WP_000139712.1.41839 WP_000139712.1.41863 WP_000139712.1.4188 WP_000139712.1.41891 WP_000139712.1.41898 WP_000139712.1.41935 WP_000139712.1.41943 WP_000139712.1.41972 WP_000139712.1.41983 WP_000139712.1.41989 WP_000139712.1.420 WP_000139712.1.42001 WP_000139712.1.42003 WP_000139712.1.42015 WP_000139712.1.42017 WP_000139712.1.4202 WP_000139712.1.42028 WP_000139712.1.42056 WP_000139712.1.42064 WP_000139712.1.42072 WP_000139712.1.42085 WP_000139712.1.42087 WP_000139712.1.42125 WP_000139712.1.42137 WP_000139712.1.42169 WP_000139712.1.42178 WP_000139712.1.42198 WP_000139712.1.42230 WP_000139712.1.42241 WP_000139712.1.4225 WP_000139712.1.42269 WP_000139712.1.42286 WP_000139712.1.42298 WP_000139712.1.42305 WP_000139712.1.42325 WP_000139712.1.42344 WP_000139712.1.42355 WP_000139712.1.42403 WP_000139712.1.42436 WP_000139712.1.42459 WP_000139712.1.42460 WP_000139712.1.42481 WP_000139712.1.42510 WP_000139712.1.42551 WP_000139712.1.42575 WP_000139712.1.42593 WP_000139712.1.426 WP_000139712.1.42607 WP_000139712.1.42640 WP_000139712.1.42652 WP_000139712.1.42667 WP_000139712.1.42668 WP_000139712.1.42674 WP_000139712.1.42679 WP_000139712.1.42681 WP_000139712.1.42733 WP_000139712.1.42737 WP_000139712.1.42738 WP_000139712.1.42740 WP_000139712.1.42759 WP_000139712.1.42764 WP_000139712.1.42786 WP_000139712.1.42788 WP_000139712.1.42798 WP_000139712.1.42816 WP_000139712.1.42819 WP_000139712.1.42837 WP_000139712.1.42848 WP_000139712.1.42883 WP_000139712.1.42897 WP_000139712.1.42907 WP_000139712.1.42925 WP_000139712.1.4293 WP_000139712.1.42959 WP_000139712.1.42984 WP_000139712.1.42985 WP_000139712.1.4299 WP_000139712.1.42990 WP_000139712.1.43014 WP_000139712.1.43020 WP_000139712.1.43023 WP_000139712.1.43047 WP_000139712.1.43061 WP_000139712.1.43072 WP_000139712.1.43095 WP_000139712.1.43110 WP_000139712.1.43114 WP_000139712.1.43122 WP_000139712.1.43125 WP_000139712.1.43131 WP_000139712.1.43134 WP_000139712.1.43139 WP_000139712.1.43143 WP_000139712.1.43147 WP_000139712.1.43159 WP_000139712.1.43165 WP_000139712.1.43168 WP_000139712.1.43179 WP_000139712.1.43200 WP_000139712.1.43202 WP_000139712.1.43204 WP_000139712.1.43206 WP_000139712.1.43225 WP_000139712.1.43232 WP_000139712.1.43248 WP_000139712.1.4325 WP_000139712.1.43252 WP_000139712.1.43263 WP_000139712.1.4327 WP_000139712.1.43274 WP_000139712.1.43279 WP_000139712.1.43323 WP_000139712.1.43331 WP_000139712.1.43341 WP_000139712.1.43360 WP_000139712.1.43369 WP_000139712.1.4337 WP_000139712.1.43375 WP_000139712.1.43405 WP_000139712.1.43406 WP_000139712.1.4341 WP_000139712.1.43410 WP_000139712.1.43414 WP_000139712.1.43446 WP_000139712.1.43460 WP_000139712.1.4347 WP_000139712.1.43506 WP_000139712.1.43512 WP_000139712.1.43530 WP_000139712.1.43550 WP_000139712.1.43560 WP_000139712.1.43573 WP_000139712.1.43617 WP_000139712.1.43618 WP_000139712.1.43627 WP_000139712.1.43659 WP_000139712.1.43665 WP_000139712.1.43670 WP_000139712.1.43683 WP_000139712.1.43693 WP_000139712.1.43702 WP_000139712.1.43703 WP_000139712.1.4372 WP_000139712.1.43731 WP_000139712.1.43752 WP_000139712.1.43784 WP_000139712.1.43788 WP_000139712.1.4380 WP_000139712.1.43800 WP_000139712.1.43819 WP_000139712.1.43827 WP_000139712.1.4385 WP_000139712.1.43851 WP_000139712.1.4386 WP_000139712.1.43904 WP_000139712.1.43915 WP_000139712.1.43964 WP_000139712.1.43984 WP_000139712.1.43988 WP_000139712.1.43995 WP_000139712.1.44074 WP_000139712.1.44095 WP_000139712.1.44119 WP_000139712.1.44153 WP_000139712.1.44177 WP_000139712.1.44178 WP_000139712.1.44181 WP_000139712.1.44186 WP_000139712.1.44195 WP_000139712.1.44265 WP_000139712.1.44302 WP_000139712.1.44331 WP_000139712.1.44344 WP_000139712.1.44382 WP_000139712.1.44388 WP_000139712.1.44405 WP_000139712.1.44420 WP_000139712.1.44432 WP_000139712.1.44504 WP_000139712.1.44515 WP_000139712.1.44517 WP_000139712.1.44520 WP_000139712.1.44536 WP_000139712.1.44544 WP_000139712.1.44579 WP_000139712.1.44586 WP_000139712.1.44588 WP_000139712.1.44605 WP_000139712.1.44623 WP_000139712.1.44631 WP_000139712.1.44655 WP_000139712.1.44667 WP_000139712.1.44672 WP_000139712.1.447 WP_000139712.1.44714 WP_000139712.1.44715 WP_000139712.1.44732 WP_000139712.1.44755 WP_000139712.1.44780 WP_000139712.1.44785 WP_000139712.1.44788 WP_000139712.1.44796 WP_000139712.1.44856 WP_000139712.1.44868 WP_000139712.1.44876 WP_000139712.1.44881 WP_000139712.1.44882 WP_000139712.1.44892 WP_000139712.1.44899 WP_000139712.1.44903 WP_000139712.1.44914 WP_000139712.1.44940 WP_000139712.1.44955 WP_000139712.1.44969 WP_000139712.1.4499 WP_000139712.1.44993 WP_000139712.1.45008 WP_000139712.1.45033 WP_000139712.1.45035 WP_000139712.1.45042 WP_000139712.1.45050 WP_000139712.1.45080 WP_000139712.1.45091 WP_000139712.1.45094 WP_000139712.1.45099 WP_000139712.1.45114 WP_000139712.1.4513 WP_000139712.1.45131 WP_000139712.1.45132 WP_000139712.1.45133 WP_000139712.1.45140 WP_000139712.1.45157 WP_000139712.1.45162 WP_000139712.1.45164 WP_000139712.1.45170 WP_000139712.1.452 WP_000139712.1.45218 WP_000139712.1.45221 WP_000139712.1.45223 WP_000139712.1.45242 WP_000139712.1.45267 WP_000139712.1.4527 WP_000139712.1.45272 WP_000139712.1.45281 WP_000139712.1.45290 WP_000139712.1.45297 WP_000139712.1.453 WP_000139712.1.45364 WP_000139712.1.45419 WP_000139712.1.45431 WP_000139712.1.45439 WP_000139712.1.4545 WP_000139712.1.45450 WP_000139712.1.45456 WP_000139712.1.4546 WP_000139712.1.45472 WP_000139712.1.45492 WP_000139712.1.4550 WP_000139712.1.45507 WP_000139712.1.45542 WP_000139712.1.45555 WP_000139712.1.45560 WP_000139712.1.45574 WP_000139712.1.45577 WP_000139712.1.45586 WP_000139712.1.45610 WP_000139712.1.45620 WP_000139712.1.45645 WP_000139712.1.45654 WP_000139712.1.45670 WP_000139712.1.45698 WP_000139712.1.45705 WP_000139712.1.45730 WP_000139712.1.45734 WP_000139712.1.45763 WP_000139712.1.45768 WP_000139712.1.4577 WP_000139712.1.45771 WP_000139712.1.45773 WP_000139712.1.45780 WP_000139712.1.4582 WP_000139712.1.45833 WP_000139712.1.4584 WP_000139712.1.45852 WP_000139712.1.45859 WP_000139712.1.45862 WP_000139712.1.45874 WP_000139712.1.45878 WP_000139712.1.45897 WP_000139712.1.45954 WP_000139712.1.4597 WP_000139712.1.45972 WP_000139712.1.45977 WP_000139712.1.45979 WP_000139712.1.4598 WP_000139712.1.46003 WP_000139712.1.46005 WP_000139712.1.46013 WP_000139712.1.46021 WP_000139712.1.46035 WP_000139712.1.46037 WP_000139712.1.46050 WP_000139712.1.46055 WP_000139712.1.46062 WP_000139712.1.46078 WP_000139712.1.46082 WP_000139712.1.46087 WP_000139712.1.46109 WP_000139712.1.46168 WP_000139712.1.46171 WP_000139712.1.46172 WP_000139712.1.46185 WP_000139712.1.46195 WP_000139712.1.46208 WP_000139712.1.46222 WP_000139712.1.46228 WP_000139712.1.46248 WP_000139712.1.46276 WP_000139712.1.46289 WP_000139712.1.46330 WP_000139712.1.46333 WP_000139712.1.46334 WP_000139712.1.46339 WP_000139712.1.46353 WP_000139712.1.46362 WP_000139712.1.46368 WP_000139712.1.46380 WP_000139712.1.46389 WP_000139712.1.46401 WP_000139712.1.46418 WP_000139712.1.46422 WP_000139712.1.46465 WP_000139712.1.46514 WP_000139712.1.46529 WP_000139712.1.46543 WP_000139712.1.46587 WP_000139712.1.46608 WP_000139712.1.46619 WP_000139712.1.4662 WP_000139712.1.46648 WP_000139712.1.46660 WP_000139712.1.46664 WP_000139712.1.46670 WP_000139712.1.46676 WP_000139712.1.46692 WP_000139712.1.46702 WP_000139712.1.46703 WP_000139712.1.46720 WP_000139712.1.46736 WP_000139712.1.46752 WP_000139712.1.46765 WP_000139712.1.46770 WP_000139712.1.4680 WP_000139712.1.46815 WP_000139712.1.46852 WP_000139712.1.46881 WP_000139712.1.46906 WP_000139712.1.46908 WP_000139712.1.46911 WP_000139712.1.46914 WP_000139712.1.46925 WP_000139712.1.46929 WP_000139712.1.46937 WP_000139712.1.4694 WP_000139712.1.46947 WP_000139712.1.4696 WP_000139712.1.46965 WP_000139712.1.46983 WP_000139712.1.46995 WP_000139712.1.47002 WP_000139712.1.47051 WP_000139712.1.47065 WP_000139712.1.47090 WP_000139712.1.47105 WP_000139712.1.47107 WP_000139712.1.47111 WP_000139712.1.47128 WP_000139712.1.47153 WP_000139712.1.47159 WP_000139712.1.47163 WP_000139712.1.47175 WP_000139712.1.47187 WP_000139712.1.47193 WP_000139712.1.47211 WP_000139712.1.47216 WP_000139712.1.47258 WP_000139712.1.47269 WP_000139712.1.47276 WP_000139712.1.47279 WP_000139712.1.4728 WP_000139712.1.47290 WP_000139712.1.47294 WP_000139712.1.47306 WP_000139712.1.47328 WP_000139712.1.47331 WP_000139712.1.47334 WP_000139712.1.47353 WP_000139712.1.47381 WP_000139712.1.47399 WP_000139712.1.47406 WP_000139712.1.47408 WP_000139712.1.47426 WP_000139712.1.47432 WP_000139712.1.47439 WP_000139712.1.47450 WP_000139712.1.47459 WP_000139712.1.47493 WP_000139712.1.47522 WP_000139712.1.47541 WP_000139712.1.47561 WP_000139712.1.47617 WP_000139712.1.47618 WP_000139712.1.47629 WP_000139712.1.47669 WP_000139712.1.4767 WP_000139712.1.47680 WP_000139712.1.477 WP_000139712.1.47702 WP_000139712.1.47719 WP_000139712.1.47733 WP_000139712.1.47747 WP_000139712.1.47763 WP_000139712.1.47782 WP_000139712.1.47835 WP_000139712.1.47836 WP_000139712.1.47851 WP_000139712.1.47859 WP_000139712.1.47864 WP_000139712.1.47872 WP_000139712.1.47873 WP_000139712.1.47904 WP_000139712.1.47908 WP_000139712.1.4792 WP_000139712.1.47989 WP_000139712.1.47996 WP_000139712.1.48011 WP_000139712.1.48030 WP_000139712.1.48046 WP_000139712.1.48047 WP_000139712.1.4805 WP_000139712.1.48057 WP_000139712.1.48064 WP_000139712.1.48067 WP_000139712.1.48116 WP_000139712.1.48142 WP_000139712.1.48149 WP_000139712.1.4815 WP_000139712.1.48154 WP_000139712.1.48156 WP_000139712.1.48169 WP_000139712.1.48186 WP_000139712.1.48187 WP_000139712.1.48199 WP_000139712.1.48205 WP_000139712.1.48212 WP_000139712.1.48223 WP_000139712.1.48227 WP_000139712.1.48236 WP_000139712.1.48250 WP_000139712.1.48272 WP_000139712.1.48282 WP_000139712.1.48284 WP_000139712.1.48293 WP_000139712.1.48307 WP_000139712.1.48310 WP_000139712.1.48322 WP_000139712.1.48335 WP_000139712.1.48338 WP_000139712.1.48376 WP_000139712.1.48391 WP_000139712.1.48394 WP_000139712.1.48398 WP_000139712.1.4840 WP_000139712.1.48425 WP_000139712.1.48427 WP_000139712.1.48437 WP_000139712.1.48438 WP_000139712.1.48463 WP_000139712.1.48479 WP_000139712.1.4852 WP_000139712.1.48556 WP_000139712.1.48563 WP_000139712.1.48577 WP_000139712.1.48580 WP_000139712.1.48593 WP_000139712.1.48634 WP_000139712.1.48656 WP_000139712.1.48664 WP_000139712.1.48670 WP_000139712.1.4868 WP_000139712.1.48705 WP_000139712.1.48711 WP_000139712.1.48723 WP_000139712.1.48769 WP_000139712.1.48775 WP_000139712.1.48782 WP_000139712.1.48805 WP_000139712.1.48817 WP_000139712.1.48818 WP_000139712.1.48823 WP_000139712.1.48833 WP_000139712.1.48835 WP_000139712.1.4886 WP_000139712.1.48869 WP_000139712.1.48936 WP_000139712.1.48941 WP_000139712.1.48945 WP_000139712.1.48951 WP_000139712.1.48968 WP_000139712.1.48982 WP_000139712.1.48993 WP_000139712.1.4901 WP_000139712.1.49018 WP_000139712.1.49032 WP_000139712.1.4905 WP_000139712.1.49071 WP_000139712.1.49094 WP_000139712.1.49105 WP_000139712.1.49128 WP_000139712.1.49129 WP_000139712.1.49143 WP_000139712.1.49152 WP_000139712.1.49154 WP_000139712.1.49159 WP_000139712.1.4916 WP_000139712.1.49161 WP_000139712.1.4917 WP_000139712.1.49171 WP_000139712.1.49173 WP_000139712.1.4918 WP_000139712.1.49189 WP_000139712.1.49196 WP_000139712.1.49199 WP_000139712.1.49207 WP_000139712.1.49234 WP_000139712.1.4924 WP_000139712.1.49248 WP_000139712.1.49257 WP_000139712.1.49301 WP_000139712.1.49326 WP_000139712.1.49327 WP_000139712.1.49330 WP_000139712.1.49362 WP_000139712.1.49398 WP_000139712.1.49418 WP_000139712.1.49444 WP_000139712.1.4945 WP_000139712.1.49479 WP_000139712.1.4950 WP_000139712.1.49518 WP_000139712.1.49530 WP_000139712.1.49539 WP_000139712.1.49549 WP_000139712.1.49581 WP_000139712.1.49582 WP_000139712.1.496 WP_000139712.1.49603 WP_000139712.1.4962 WP_000139712.1.49643 WP_000139712.1.49653 WP_000139712.1.49669 WP_000139712.1.49672 WP_000139712.1.49690 WP_000139712.1.49704 WP_000139712.1.49715 WP_000139712.1.49728 WP_000139712.1.49730 WP_000139712.1.49732 WP_000139712.1.49742 WP_000139712.1.49745 WP_000139712.1.4980 WP_000139712.1.49800 WP_000139712.1.49819 WP_000139712.1.4982 WP_000139712.1.4984 WP_000139712.1.49860 WP_000139712.1.49871 WP_000139712.1.4989 WP_000139712.1.49894 WP_000139712.1.49907 WP_000139712.1.49913 WP_000139712.1.49918 WP_000139712.1.49921 WP_000139712.1.49934 WP_000139712.1.49935 WP_000139712.1.49936 WP_000139712.1.4994 WP_000139712.1.49970 WP_000139712.1.49982 WP_000139712.1.50013 WP_000139712.1.50015 WP_000139712.1.50028 WP_000139712.1.50038 WP_000139712.1.50039 WP_000139712.1.50061 WP_000139712.1.50076 WP_000139712.1.50117 WP_000139712.1.5013 WP_000139712.1.50138 WP_000139712.1.50145 WP_000139712.1.50192 WP_000139712.1.50217 WP_000139712.1.50219 WP_000139712.1.50229 WP_000139712.1.50261 WP_000139712.1.50291 WP_000139712.1.50313 WP_000139712.1.50314 WP_000139712.1.50356 WP_000139712.1.50360 WP_000139712.1.50367 WP_000139712.1.50369 WP_000139712.1.50377 WP_000139712.1.50388 WP_000139712.1.50425 WP_000139712.1.50430 WP_000139712.1.50431 WP_000139712.1.5045 WP_000139712.1.50464 WP_000139712.1.50477 WP_000139712.1.50516 WP_000139712.1.50525 WP_000139712.1.50536 WP_000139712.1.50555 WP_000139712.1.50556 WP_000139712.1.50558 WP_000139712.1.50568 WP_000139712.1.50578 WP_000139712.1.5059 WP_000139712.1.50594 WP_000139712.1.50595 WP_000139712.1.50647 WP_000139712.1.50660 WP_000139712.1.50669 WP_000139712.1.50699 WP_000139712.1.50740 WP_000139712.1.50759 WP_000139712.1.50768 WP_000139712.1.50799 WP_000139712.1.50817 WP_000139712.1.50820 WP_000139712.1.50827 WP_000139712.1.50829 WP_000139712.1.5087 WP_000139712.1.50884 WP_000139712.1.50896 WP_000139712.1.50937 WP_000139712.1.50962 WP_000139712.1.50974 WP_000139712.1.51008 WP_000139712.1.51015 WP_000139712.1.51062 WP_000139712.1.5108 WP_000139712.1.51085 WP_000139712.1.5109 WP_000139712.1.5110 WP_000139712.1.5111 WP_000139712.1.51130 WP_000139712.1.51138 WP_000139712.1.51152 WP_000139712.1.51209 WP_000139712.1.51226 WP_000139712.1.51236 WP_000139712.1.51245 WP_000139712.1.51250 WP_000139712.1.51271 WP_000139712.1.51277 WP_000139712.1.51282 WP_000139712.1.51295 WP_000139712.1.51306 WP_000139712.1.51310 WP_000139712.1.51326 WP_000139712.1.51346 WP_000139712.1.51365 WP_000139712.1.51376 WP_000139712.1.51393 WP_000139712.1.51403 WP_000139712.1.51454 WP_000139712.1.51456 WP_000139712.1.51465 WP_000139712.1.51492 WP_000139712.1.51496 WP_000139712.1.515 WP_000139712.1.51527 WP_000139712.1.5155 WP_000139712.1.51557 WP_000139712.1.51559 WP_000139712.1.51571 WP_000139712.1.51575 WP_000139712.1.51590 WP_000139712.1.51665 WP_000139712.1.51672 WP_000139712.1.51716 WP_000139712.1.51741 WP_000139712.1.51744 WP_000139712.1.51748 WP_000139712.1.51787 WP_000139712.1.51794 WP_000139712.1.51797 WP_000139712.1.51812 WP_000139712.1.51824 WP_000139712.1.51836 WP_000139712.1.51842 WP_000139712.1.51844 WP_000139712.1.5186 WP_000139712.1.51871 WP_000139712.1.51883 WP_000139712.1.5190 WP_000139712.1.51912 WP_000139712.1.51920 WP_000139712.1.51924 WP_000139712.1.51936 WP_000139712.1.51952 WP_000139712.1.51971 WP_000139712.1.51995 WP_000139712.1.52034 WP_000139712.1.52072 WP_000139712.1.52078 WP_000139712.1.521 WP_000139712.1.5213 WP_000139712.1.52151 WP_000139712.1.52162 WP_000139712.1.52182 WP_000139712.1.52185 WP_000139712.1.52193 WP_000139712.1.52195 WP_000139712.1.52198 WP_000139712.1.52210 WP_000139712.1.52224 WP_000139712.1.52251 WP_000139712.1.52252 WP_000139712.1.52259 WP_000139712.1.52289 WP_000139712.1.52296 WP_000139712.1.523 WP_000139712.1.52308 WP_000139712.1.5231 WP_000139712.1.52322 WP_000139712.1.52327 WP_000139712.1.52331 WP_000139712.1.52340 WP_000139712.1.52343 WP_000139712.1.52377 WP_000139712.1.52396 WP_000139712.1.52423 WP_000139712.1.52427 WP_000139712.1.52440 WP_000139712.1.52442 WP_000139712.1.52452 WP_000139712.1.52464 WP_000139712.1.5251 WP_000139712.1.52511 WP_000139712.1.52518 WP_000139712.1.52536 WP_000139712.1.52548 WP_000139712.1.52605 WP_000139712.1.52623 WP_000139712.1.52624 WP_000139712.1.52633 WP_000139712.1.52645 WP_000139712.1.52670 WP_000139712.1.52687 WP_000139712.1.52699 WP_000139712.1.52715 WP_000139712.1.52722 WP_000139712.1.52751 WP_000139712.1.52772 WP_000139712.1.52820 WP_000139712.1.52830 WP_000139712.1.52838 WP_000139712.1.52848 WP_000139712.1.52865 WP_000139712.1.52877 WP_000139712.1.52878 WP_000139712.1.52886 WP_000139712.1.52889 WP_000139712.1.52900 WP_000139712.1.52904 WP_000139712.1.52941 WP_000139712.1.52947 WP_000139712.1.52965 WP_000139712.1.52983 WP_000139712.1.52984 WP_000139712.1.53002 WP_000139712.1.53007 WP_000139712.1.5304 WP_000139712.1.53050 WP_000139712.1.53057 WP_000139712.1.53071 WP_000139712.1.53077 WP_000139712.1.53140 WP_000139712.1.53153 WP_000139712.1.53178 WP_000139712.1.53209 WP_000139712.1.5323 WP_000139712.1.53245 WP_000139712.1.53260 WP_000139712.1.53312 WP_000139712.1.53317 WP_000139712.1.53319 WP_000139712.1.53323 WP_000139712.1.53352 WP_000139712.1.53363 WP_000139712.1.53372 WP_000139712.1.53373 WP_000139712.1.53379 WP_000139712.1.53387 WP_000139712.1.53394 WP_000139712.1.53403 WP_000139712.1.53408 WP_000139712.1.53418 WP_000139712.1.53432 WP_000139712.1.53433 WP_000139712.1.53452 WP_000139712.1.53462 WP_000139712.1.53467 WP_000139712.1.5347 WP_000139712.1.53488 WP_000139712.1.53503 WP_000139712.1.53521 WP_000139712.1.53532 WP_000139712.1.53577 WP_000139712.1.53641 WP_000139712.1.53648 WP_000139712.1.53661 WP_000139712.1.53671 WP_000139712.1.53682 WP_000139712.1.53691 WP_000139712.1.53712 WP_000139712.1.53714 WP_000139712.1.53759 WP_000139712.1.53763 WP_000139712.1.53766 WP_000139712.1.53774 WP_000139712.1.53786 WP_000139712.1.53799 WP_000139712.1.53827 WP_000139712.1.53835 WP_000139712.1.53889 WP_000139712.1.53911 WP_000139712.1.53915 WP_000139712.1.53926 WP_000139712.1.53934 WP_000139712.1.53969 WP_000139712.1.53999 WP_000139712.1.5401 WP_000139712.1.54022 WP_000139712.1.54049 WP_000139712.1.54074 WP_000139712.1.54086 WP_000139712.1.54094 WP_000139712.1.54109 WP_000139712.1.54135 WP_000139712.1.54147 WP_000139712.1.54229 WP_000139712.1.54237 WP_000139712.1.54253 WP_000139712.1.54269 WP_000139712.1.54290 WP_000139712.1.54297 WP_000139712.1.54299 WP_000139712.1.54373 WP_000139712.1.54395 WP_000139712.1.544 WP_000139712.1.54404 WP_000139712.1.54413 WP_000139712.1.54438 WP_000139712.1.54446 WP_000139712.1.54471 WP_000139712.1.54477 WP_000139712.1.54479 WP_000139712.1.54485 WP_000139712.1.54491 WP_000139712.1.54503 WP_000139712.1.54510 WP_000139712.1.54543 WP_000139712.1.54551 WP_000139712.1.54554 WP_000139712.1.54574 WP_000139712.1.54637 WP_000139712.1.54675 WP_000139712.1.5469 WP_000139712.1.54728 WP_000139712.1.54744 WP_000139712.1.54745 WP_000139712.1.54753 WP_000139712.1.54830 WP_000139712.1.54847 WP_000139712.1.54851 WP_000139712.1.54878 WP_000139712.1.54914 WP_000139712.1.54929 WP_000139712.1.54931 WP_000139712.1.54955 WP_000139712.1.54967 WP_000139712.1.54990 WP_000139712.1.5500 WP_000139712.1.55004 WP_000139712.1.55014 WP_000139712.1.55058 WP_000139712.1.55082 WP_000139712.1.55084 WP_000139712.1.55090 WP_000139712.1.55095 WP_000139712.1.55100 WP_000139712.1.55139 WP_000139712.1.5518 WP_000139712.1.5519 WP_000139712.1.552 WP_000139712.1.55214 WP_000139712.1.55239 WP_000139712.1.55271 WP_000139712.1.55272 WP_000139712.1.55274 WP_000139712.1.55309 WP_000139712.1.55327 WP_000139712.1.55336 WP_000139712.1.55352 WP_000139712.1.55353 WP_000139712.1.55367 WP_000139712.1.55369 WP_000139712.1.55403 WP_000139712.1.55405 WP_000139712.1.55419 WP_000139712.1.55421 WP_000139712.1.55495 WP_000139712.1.5550 WP_000139712.1.55508 WP_000139712.1.55527 WP_000139712.1.55535 WP_000139712.1.5554 WP_000139712.1.55544 WP_000139712.1.55558 WP_000139712.1.5556 WP_000139712.1.55583 WP_000139712.1.5559 WP_000139712.1.55603 WP_000139712.1.5562 WP_000139712.1.55620 WP_000139712.1.55628 WP_000139712.1.55637 WP_000139712.1.5565 WP_000139712.1.55653 WP_000139712.1.55657 WP_000139712.1.557 WP_000139712.1.55717 WP_000139712.1.55719 WP_000139712.1.55724 WP_000139712.1.55728 WP_000139712.1.5575 WP_000139712.1.55784 WP_000139712.1.55786 WP_000139712.1.5580 WP_000139712.1.55818 WP_000139712.1.55831 WP_000139712.1.55835 WP_000139712.1.55839 WP_000139712.1.55845 WP_000139712.1.55848 WP_000139712.1.55859 WP_000139712.1.55867 WP_000139712.1.55886 WP_000139712.1.5589 WP_000139712.1.55904 WP_000139712.1.55916 WP_000139712.1.55933 WP_000139712.1.55949 WP_000139712.1.55953 WP_000139712.1.55955 WP_000139712.1.55960 WP_000139712.1.55985 WP_000139712.1.56000 WP_000139712.1.56003 WP_000139712.1.56025 WP_000139712.1.5604 WP_000139712.1.56048 WP_000139712.1.56064 WP_000139712.1.56078 WP_000139712.1.56098 WP_000139712.1.56099 WP_000139712.1.56106 WP_000139712.1.56135 WP_000139712.1.56159 WP_000139712.1.56200 WP_000139712.1.56210 WP_000139712.1.56213 WP_000139712.1.56220 WP_000139712.1.56225 WP_000139712.1.5623 WP_000139712.1.56237 WP_000139712.1.56239 WP_000139712.1.56241 WP_000139712.1.56260 WP_000139712.1.56265 WP_000139712.1.56272 WP_000139712.1.56275 WP_000139712.1.56281 WP_000139712.1.56332 WP_000139712.1.56333 WP_000139712.1.5635 WP_000139712.1.56364 WP_000139712.1.5637 WP_000139712.1.56377 WP_000139712.1.56387 WP_000139712.1.56400 WP_000139712.1.5644 WP_000139712.1.56464 WP_000139712.1.56482 WP_000139712.1.56522 WP_000139712.1.56525 WP_000139712.1.56530 WP_000139712.1.56542 WP_000139712.1.56558 WP_000139712.1.5658 WP_000139712.1.56584 WP_000139712.1.56598 WP_000139712.1.566 WP_000139712.1.56608 WP_000139712.1.56619 WP_000139712.1.56628 WP_000139712.1.56641 WP_000139712.1.56658 WP_000139712.1.5666 WP_000139712.1.56679 WP_000139712.1.56702 WP_000139712.1.56708 WP_000139712.1.56737 WP_000139712.1.5675 WP_000139712.1.56767 WP_000139712.1.5677 WP_000139712.1.56778 WP_000139712.1.56779 WP_000139712.1.56794 WP_000139712.1.56815 WP_000139712.1.56822 WP_000139712.1.56856 WP_000139712.1.5686 WP_000139712.1.56865 WP_000139712.1.56878 WP_000139712.1.569 WP_000139712.1.56903 WP_000139712.1.56931 WP_000139712.1.56966 WP_000139712.1.56975 WP_000139712.1.56986 WP_000139712.1.57015 WP_000139712.1.57047 WP_000139712.1.5705 WP_000139712.1.57073 WP_000139712.1.57075 WP_000139712.1.57080 WP_000139712.1.57081 WP_000139712.1.57097 WP_000139712.1.57109 WP_000139712.1.57115 WP_000139712.1.57141 WP_000139712.1.57158 WP_000139712.1.57170 WP_000139712.1.5718 WP_000139712.1.57190 WP_000139712.1.57196 WP_000139712.1.57214 WP_000139712.1.57265 WP_000139712.1.57271 WP_000139712.1.57291 WP_000139712.1.57309 WP_000139712.1.57330 WP_000139712.1.57338 WP_000139712.1.5735 WP_000139712.1.57385 WP_000139712.1.57389 WP_000139712.1.57427 WP_000139712.1.5743 WP_000139712.1.57445 WP_000139712.1.57448 WP_000139712.1.57459 WP_000139712.1.57481 WP_000139712.1.5749 WP_000139712.1.57577 WP_000139712.1.57593 WP_000139712.1.57594 WP_000139712.1.57612 WP_000139712.1.57635 WP_000139712.1.57650 WP_000139712.1.57665 WP_000139712.1.57670 WP_000139712.1.57682 WP_000139712.1.57692 WP_000139712.1.57693 WP_000139712.1.57701 WP_000139712.1.57718 WP_000139712.1.57723 WP_000139712.1.57727 WP_000139712.1.57730 WP_000139712.1.57734 WP_000139712.1.57745 WP_000139712.1.57754 WP_000139712.1.57783 WP_000139712.1.57808 WP_000139712.1.57819 WP_000139712.1.57837 WP_000139712.1.57840 WP_000139712.1.57844 WP_000139712.1.57861 WP_000139712.1.57878 WP_000139712.1.5791 WP_000139712.1.57928 WP_000139712.1.57943 WP_000139712.1.57952 WP_000139712.1.57962 WP_000139712.1.57974 WP_000139712.1.5799 WP_000139712.1.58006 WP_000139712.1.58016 WP_000139712.1.58035 WP_000139712.1.58049 WP_000139712.1.58051 WP_000139712.1.58074 WP_000139712.1.58116 WP_000139712.1.58122 WP_000139712.1.58127 WP_000139712.1.58139 WP_000139712.1.58148 WP_000139712.1.58158 WP_000139712.1.5816 WP_000139712.1.5817 WP_000139712.1.58185 WP_000139712.1.58198 WP_000139712.1.58212 WP_000139712.1.58241 WP_000139712.1.58246 WP_000139712.1.5827 WP_000139712.1.58277 WP_000139712.1.58317 WP_000139712.1.58321 WP_000139712.1.58325 WP_000139712.1.58350 WP_000139712.1.58352 WP_000139712.1.58353 WP_000139712.1.58364 WP_000139712.1.58366 WP_000139712.1.58373 WP_000139712.1.58392 WP_000139712.1.58395 WP_000139712.1.58419 WP_000139712.1.58421 WP_000139712.1.58430 WP_000139712.1.58435 WP_000139712.1.58481 WP_000139712.1.5849 WP_000139712.1.58495 WP_000139712.1.58497 WP_000139712.1.58508 WP_000139712.1.58512 WP_000139712.1.58521 WP_000139712.1.58530 WP_000139712.1.58538 WP_000139712.1.5857 WP_000139712.1.58571 WP_000139712.1.58584 WP_000139712.1.58588 WP_000139712.1.58592 WP_000139712.1.58598 WP_000139712.1.586 WP_000139712.1.58603 WP_000139712.1.58626 WP_000139712.1.58686 WP_000139712.1.58704 WP_000139712.1.58714 WP_000139712.1.58718 WP_000139712.1.58735 WP_000139712.1.58760 WP_000139712.1.58763 WP_000139712.1.58772 WP_000139712.1.58775 WP_000139712.1.5880 WP_000139712.1.58833 WP_000139712.1.58855 WP_000139712.1.58860 WP_000139712.1.58934 WP_000139712.1.58936 WP_000139712.1.58960 WP_000139712.1.58981 WP_000139712.1.58998 WP_000139712.1.5901 WP_000139712.1.59011 WP_000139712.1.59014 WP_000139712.1.59039 WP_000139712.1.5904 WP_000139712.1.59062 WP_000139712.1.59077 WP_000139712.1.59098 WP_000139712.1.59124 WP_000139712.1.59133 WP_000139712.1.59146 WP_000139712.1.59178 WP_000139712.1.59187 WP_000139712.1.5920 WP_000139712.1.5925 WP_000139712.1.59269 WP_000139712.1.59284 WP_000139712.1.59311 WP_000139712.1.59327 WP_000139712.1.59329 WP_000139712.1.59334 WP_000139712.1.59337 WP_000139712.1.59363 WP_000139712.1.5938 WP_000139712.1.59380 WP_000139712.1.59397 WP_000139712.1.59398 WP_000139712.1.5940 WP_000139712.1.59404 WP_000139712.1.59414 WP_000139712.1.59457 WP_000139712.1.59459 WP_000139712.1.59462 WP_000139712.1.59464 WP_000139712.1.59467 WP_000139712.1.59478 WP_000139712.1.59498 WP_000139712.1.59540 WP_000139712.1.59546 WP_000139712.1.59594 WP_000139712.1.59598 WP_000139712.1.59603 WP_000139712.1.59609 WP_000139712.1.59624 WP_000139712.1.59629 WP_000139712.1.59643 WP_000139712.1.59663 WP_000139712.1.59668 WP_000139712.1.59669 WP_000139712.1.59671 WP_000139712.1.59697 WP_000139712.1.5972 WP_000139712.1.59736 WP_000139712.1.59787 WP_000139712.1.59803 WP_000139712.1.59819 WP_000139712.1.5982 WP_000139712.1.59822 WP_000139712.1.59864 WP_000139712.1.59874 WP_000139712.1.59881 WP_000139712.1.59886 WP_000139712.1.59907 WP_000139712.1.59915 WP_000139712.1.59921 WP_000139712.1.59945 WP_000139712.1.59977 WP_000139712.1.60006 WP_000139712.1.60022 WP_000139712.1.6006 WP_000139712.1.60086 WP_000139712.1.60101 WP_000139712.1.6011 WP_000139712.1.60118 WP_000139712.1.60123 WP_000139712.1.60147 WP_000139712.1.60149 WP_000139712.1.60156 WP_000139712.1.60157 WP_000139712.1.60158 WP_000139712.1.6017 WP_000139712.1.60181 WP_000139712.1.60201 WP_000139712.1.60227 WP_000139712.1.60251 WP_000139712.1.60259 WP_000139712.1.60280 WP_000139712.1.60302 WP_000139712.1.60307 WP_000139712.1.60339 WP_000139712.1.60345 WP_000139712.1.60353 WP_000139712.1.60355 WP_000139712.1.60360 WP_000139712.1.60368 WP_000139712.1.60431 WP_000139712.1.60434 WP_000139712.1.60462 WP_000139712.1.60492 WP_000139712.1.60515 WP_000139712.1.60547 WP_000139712.1.60551 WP_000139712.1.60585 WP_000139712.1.60594 WP_000139712.1.60595 WP_000139712.1.60636 WP_000139712.1.60641 WP_000139712.1.60690 WP_000139712.1.60696 WP_000139712.1.60719 WP_000139712.1.60730 WP_000139712.1.60734 WP_000139712.1.60742 WP_000139712.1.60750 WP_000139712.1.60751 WP_000139712.1.60758 WP_000139712.1.60759 WP_000139712.1.60765 WP_000139712.1.60778 WP_000139712.1.60787 WP_000139712.1.60813 WP_000139712.1.60820 WP_000139712.1.60845 WP_000139712.1.6085 WP_000139712.1.60859 WP_000139712.1.60869 WP_000139712.1.60888 WP_000139712.1.60898 WP_000139712.1.60912 WP_000139712.1.60917 WP_000139712.1.60923 WP_000139712.1.60934 WP_000139712.1.60939 WP_000139712.1.60946 WP_000139712.1.60948 WP_000139712.1.60965 WP_000139712.1.60981 WP_000139712.1.60991 WP_000139712.1.61009 WP_000139712.1.61013 WP_000139712.1.61019 WP_000139712.1.61023 WP_000139712.1.61026 WP_000139712.1.61029 WP_000139712.1.61030 WP_000139712.1.61031 WP_000139712.1.61082 WP_000139712.1.61115 WP_000139712.1.61119 WP_000139712.1.61139 WP_000139712.1.61152 WP_000139712.1.61153 WP_000139712.1.6118 WP_000139712.1.61188 WP_000139712.1.61189 WP_000139712.1.6119 WP_000139712.1.61224 WP_000139712.1.6123 WP_000139712.1.61257 WP_000139712.1.61263 WP_000139712.1.61271 WP_000139712.1.61286 WP_000139712.1.61289 WP_000139712.1.61313 WP_000139712.1.61316 WP_000139712.1.61318 WP_000139712.1.61324 WP_000139712.1.61327 WP_000139712.1.61339 WP_000139712.1.61346 WP_000139712.1.6136 WP_000139712.1.61375 WP_000139712.1.61393 WP_000139712.1.61394 WP_000139712.1.61408 WP_000139712.1.61413 WP_000139712.1.61421 WP_000139712.1.61430 WP_000139712.1.61439 WP_000139712.1.61440 WP_000139712.1.6149 WP_000139712.1.61515 WP_000139712.1.61547 WP_000139712.1.61555 WP_000139712.1.61585 WP_000139712.1.61591 WP_000139712.1.61597 WP_000139712.1.61615 WP_000139712.1.61639 WP_000139712.1.61653 WP_000139712.1.6166 WP_000139712.1.6168 WP_000139712.1.61705 WP_000139712.1.61709 WP_000139712.1.61713 WP_000139712.1.61749 WP_000139712.1.61776 WP_000139712.1.61784 WP_000139712.1.61800 WP_000139712.1.61802 WP_000139712.1.61831 WP_000139712.1.61838 WP_000139712.1.61843 WP_000139712.1.6188 WP_000139712.1.61897 WP_000139712.1.619 WP_000139712.1.61903 WP_000139712.1.61910 WP_000139712.1.61936 WP_000139712.1.61962 WP_000139712.1.61970 WP_000139712.1.61976 WP_000139712.1.61978 WP_000139712.1.62002 WP_000139712.1.6201 WP_000139712.1.62028 WP_000139712.1.62030 WP_000139712.1.62069 WP_000139712.1.62071 WP_000139712.1.6208 WP_000139712.1.62084 WP_000139712.1.62085 WP_000139712.1.62088 WP_000139712.1.62093 WP_000139712.1.62096 WP_000139712.1.62127 WP_000139712.1.62140 WP_000139712.1.62164 WP_000139712.1.62247 WP_000139712.1.62254 WP_000139712.1.62318 WP_000139712.1.6234 WP_000139712.1.62346 WP_000139712.1.62352 WP_000139712.1.62367 WP_000139712.1.62382 WP_000139712.1.62392 WP_000139712.1.62398 WP_000139712.1.62409 WP_000139712.1.62429 WP_000139712.1.62437 WP_000139712.1.62453 WP_000139712.1.62459 WP_000139712.1.62462 WP_000139712.1.62474 WP_000139712.1.62496 WP_000139712.1.6250 WP_000139712.1.62537 WP_000139712.1.62539 WP_000139712.1.62553 WP_000139712.1.62563 WP_000139712.1.62575 WP_000139712.1.62602 WP_000139712.1.62608 WP_000139712.1.62625 WP_000139712.1.62630 WP_000139712.1.62653 WP_000139712.1.6266 WP_000139712.1.62671 WP_000139712.1.62674 WP_000139712.1.6268 WP_000139712.1.62684 WP_000139712.1.62685 WP_000139712.1.62723 WP_000139712.1.62740 WP_000139712.1.62756 WP_000139712.1.62764 WP_000139712.1.62771 WP_000139712.1.62781 WP_000139712.1.62796 WP_000139712.1.62808 WP_000139712.1.62822 WP_000139712.1.62824 WP_000139712.1.62829 WP_000139712.1.62831 WP_000139712.1.62842 WP_000139712.1.62860 WP_000139712.1.62863 WP_000139712.1.62878 WP_000139712.1.62880 WP_000139712.1.62925 WP_000139712.1.62956 WP_000139712.1.62970 WP_000139712.1.63003 WP_000139712.1.63011 WP_000139712.1.63021 WP_000139712.1.63027 WP_000139712.1.63050 WP_000139712.1.63068 WP_000139712.1.63070 WP_000139712.1.63083 WP_000139712.1.631 WP_000139712.1.63107 WP_000139712.1.63131 WP_000139712.1.63132 WP_000139712.1.63139 WP_000139712.1.63140 WP_000139712.1.63170 WP_000139712.1.63182 WP_000139712.1.63195 WP_000139712.1.63215 WP_000139712.1.63220 WP_000139712.1.63233 WP_000139712.1.63244 WP_000139712.1.63255 WP_000139712.1.63266 WP_000139712.1.63273 WP_000139712.1.63279 WP_000139712.1.63288 WP_000139712.1.63289 WP_000139712.1.63296 WP_000139712.1.63304 WP_000139712.1.63307 WP_000139712.1.63313 WP_000139712.1.63319 WP_000139712.1.63322 WP_000139712.1.63324 WP_000139712.1.63333 WP_000139712.1.63335 WP_000139712.1.63337 WP_000139712.1.63341 WP_000139712.1.63383 WP_000139712.1.634 WP_000139712.1.63406 WP_000139712.1.63411 WP_000139712.1.63421 WP_000139712.1.63441 WP_000139712.1.63460 WP_000139712.1.63469 WP_000139712.1.63471 WP_000139712.1.63510 WP_000139712.1.63527 WP_000139712.1.63540 WP_000139712.1.6355 WP_000139712.1.63565 WP_000139712.1.63589 WP_000139712.1.63617 WP_000139712.1.63672 WP_000139712.1.63673 WP_000139712.1.63678 WP_000139712.1.63693 WP_000139712.1.63704 WP_000139712.1.63705 WP_000139712.1.63726 WP_000139712.1.63729 WP_000139712.1.6374 WP_000139712.1.63751 WP_000139712.1.63759 WP_000139712.1.63763 WP_000139712.1.63774 WP_000139712.1.6378 WP_000139712.1.63828 WP_000139712.1.63847 WP_000139712.1.63874 WP_000139712.1.63878 WP_000139712.1.6388 WP_000139712.1.63890 WP_000139712.1.63894 WP_000139712.1.63895 WP_000139712.1.63907 WP_000139712.1.63910 WP_000139712.1.63947 WP_000139712.1.63975 WP_000139712.1.63998 WP_000139712.1.64012 WP_000139712.1.6403 WP_000139712.1.64060 WP_000139712.1.6408 WP_000139712.1.64094 WP_000139712.1.64108 WP_000139712.1.64181 WP_000139712.1.64192 WP_000139712.1.64207 WP_000139712.1.64232 WP_000139712.1.64250 WP_000139712.1.64251 WP_000139712.1.64279 WP_000139712.1.64303 WP_000139712.1.64304 WP_000139712.1.64367 WP_000139712.1.64368 WP_000139712.1.6438 WP_000139712.1.64400 WP_000139712.1.64408 WP_000139712.1.64434 WP_000139712.1.64446 WP_000139712.1.64456 WP_000139712.1.64457 WP_000139712.1.64473 WP_000139712.1.645 WP_000139712.1.64525 WP_000139712.1.6453 WP_000139712.1.64537 WP_000139712.1.64549 WP_000139712.1.64565 WP_000139712.1.64583 WP_000139712.1.6459 WP_000139712.1.64598 WP_000139712.1.6462 WP_000139712.1.64628 WP_000139712.1.64631 WP_000139712.1.64643 WP_000139712.1.64665 WP_000139712.1.64677 WP_000139712.1.64686 WP_000139712.1.64720 WP_000139712.1.64765 WP_000139712.1.6479 WP_000139712.1.64811 WP_000139712.1.64845 WP_000139712.1.64858 WP_000139712.1.64860 WP_000139712.1.64879 WP_000139712.1.6488 WP_000139712.1.64893 WP_000139712.1.64897 WP_000139712.1.64911 WP_000139712.1.64928 WP_000139712.1.64935 WP_000139712.1.64951 WP_000139712.1.64956 WP_000139712.1.64961 WP_000139712.1.64994 WP_000139712.1.64996 WP_000139712.1.64998 WP_000139712.1.65025 WP_000139712.1.65038 WP_000139712.1.65044 WP_000139712.1.65046 WP_000139712.1.65076 WP_000139712.1.6509 WP_000139712.1.65132 WP_000139712.1.65158 WP_000139712.1.65164 WP_000139712.1.65180 WP_000139712.1.65193 WP_000139712.1.65203 WP_000139712.1.65217 WP_000139712.1.65233 WP_000139712.1.65243 WP_000139712.1.65264 WP_000139712.1.65274 WP_000139712.1.6531 WP_000139712.1.65317 WP_000139712.1.65358 WP_000139712.1.65367 WP_000139712.1.65387 WP_000139712.1.65406 WP_000139712.1.65407 WP_000139712.1.65419 WP_000139712.1.65423 WP_000139712.1.65432 WP_000139712.1.6544 WP_000139712.1.65443 WP_000139712.1.65448 WP_000139712.1.65451 WP_000139712.1.6547 WP_000139712.1.65504 WP_000139712.1.6551 WP_000139712.1.65520 WP_000139712.1.65544 WP_000139712.1.65562 WP_000139712.1.65585 WP_000139712.1.65599 WP_000139712.1.65600 WP_000139712.1.65616 WP_000139712.1.65629 WP_000139712.1.65643 WP_000139712.1.65656 WP_000139712.1.65675 WP_000139712.1.6568 WP_000139712.1.65689 WP_000139712.1.65693 WP_000139712.1.65700 WP_000139712.1.65703 WP_000139712.1.65704 WP_000139712.1.65705 WP_000139712.1.65713 WP_000139712.1.65734 WP_000139712.1.65769 WP_000139712.1.6578 WP_000139712.1.65809 WP_000139712.1.6585 WP_000139712.1.65856 WP_000139712.1.65892 WP_000139712.1.65922 WP_000139712.1.65928 WP_000139712.1.65931 WP_000139712.1.65935 WP_000139712.1.65947 WP_000139712.1.65948 WP_000139712.1.65965 WP_000139712.1.65990 WP_000139712.1.66009 WP_000139712.1.66014 WP_000139712.1.6603 WP_000139712.1.66054 WP_000139712.1.66056 WP_000139712.1.66069 WP_000139712.1.66073 WP_000139712.1.66081 WP_000139712.1.661 WP_000139712.1.6612 WP_000139712.1.66120 WP_000139712.1.66130 WP_000139712.1.66133 WP_000139712.1.66144 WP_000139712.1.66175 WP_000139712.1.66227 WP_000139712.1.66262 WP_000139712.1.66265 WP_000139712.1.66298 WP_000139712.1.66302 WP_000139712.1.6632 WP_000139712.1.66328 WP_000139712.1.66366 WP_000139712.1.66433 WP_000139712.1.66453 WP_000139712.1.66505 WP_000139712.1.66513 WP_000139712.1.66518 WP_000139712.1.66519 WP_000139712.1.66542 WP_000139712.1.66556 WP_000139712.1.66564 WP_000139712.1.66588 WP_000139712.1.66598 WP_000139712.1.66601 WP_000139712.1.66606 WP_000139712.1.66611 WP_000139712.1.66614 WP_000139712.1.6662 WP_000139712.1.66645 WP_000139712.1.66664 WP_000139712.1.66677 WP_000139712.1.6668 WP_000139712.1.66690 WP_000139712.1.66705 WP_000139712.1.66711 WP_000139712.1.6674 WP_000139712.1.66756 WP_000139712.1.66766 WP_000139712.1.66786 WP_000139712.1.66792 WP_000139712.1.66803 WP_000139712.1.66816 WP_000139712.1.66818 WP_000139712.1.6684 WP_000139712.1.66853 WP_000139712.1.66879 WP_000139712.1.6688 WP_000139712.1.66906 WP_000139712.1.66938 WP_000139712.1.66969 WP_000139712.1.6700 WP_000139712.1.67012 WP_000139712.1.67014 WP_000139712.1.67016 WP_000139712.1.67067 WP_000139712.1.67072 WP_000139712.1.67112 WP_000139712.1.67113 WP_000139712.1.67135 WP_000139712.1.67152 WP_000139712.1.67155 WP_000139712.1.67160 WP_000139712.1.67191 WP_000139712.1.6722 WP_000139712.1.67238 WP_000139712.1.67251 WP_000139712.1.67259 WP_000139712.1.6726 WP_000139712.1.67266 WP_000139712.1.67286 WP_000139712.1.67294 WP_000139712.1.67296 WP_000139712.1.67312 WP_000139712.1.67328 WP_000139712.1.67329 WP_000139712.1.67333 WP_000139712.1.67375 WP_000139712.1.67379 WP_000139712.1.67384 WP_000139712.1.6740 WP_000139712.1.67414 WP_000139712.1.67418 WP_000139712.1.67420 WP_000139712.1.67425 WP_000139712.1.67447 WP_000139712.1.67457 WP_000139712.1.67460 WP_000139712.1.67463 WP_000139712.1.67480 WP_000139712.1.67505 WP_000139712.1.67507 WP_000139712.1.67520 WP_000139712.1.67521 WP_000139712.1.67540 WP_000139712.1.67554 WP_000139712.1.67571 WP_000139712.1.67572 WP_000139712.1.67620 WP_000139712.1.67621 WP_000139712.1.67632 WP_000139712.1.67644 WP_000139712.1.67651 WP_000139712.1.67652 WP_000139712.1.67653 WP_000139712.1.67691 WP_000139712.1.67712 WP_000139712.1.67713 WP_000139712.1.67722 WP_000139712.1.67754 WP_000139712.1.67762 WP_000139712.1.67798 WP_000139712.1.67800 WP_000139712.1.67806 WP_000139712.1.67808 WP_000139712.1.67815 WP_000139712.1.67834 WP_000139712.1.6786 WP_000139712.1.67865 WP_000139712.1.67867 WP_000139712.1.67880 WP_000139712.1.67900 WP_000139712.1.67925 WP_000139712.1.67931 WP_000139712.1.67986 WP_000139712.1.67991 WP_000139712.1.68020 WP_000139712.1.68033 WP_000139712.1.68054 WP_000139712.1.68066 WP_000139712.1.68101 WP_000139712.1.6811 WP_000139712.1.68111 WP_000139712.1.68134 WP_000139712.1.68139 WP_000139712.1.68141 WP_000139712.1.68152 WP_000139712.1.68160 WP_000139712.1.68161 WP_000139712.1.68221 WP_000139712.1.68223 WP_000139712.1.68233 WP_000139712.1.6824 WP_000139712.1.68261 WP_000139712.1.68268 WP_000139712.1.68286 WP_000139712.1.68295 WP_000139712.1.68296 WP_000139712.1.68299 WP_000139712.1.6830 WP_000139712.1.68307 WP_000139712.1.68334 WP_000139712.1.6834 WP_000139712.1.68343 WP_000139712.1.68351 WP_000139712.1.68355 WP_000139712.1.68366 WP_000139712.1.68367 WP_000139712.1.6839 WP_000139712.1.68392 WP_000139712.1.68397 WP_000139712.1.68398 WP_000139712.1.68399 WP_000139712.1.68404 WP_000139712.1.68425 WP_000139712.1.68476 WP_000139712.1.68479 WP_000139712.1.68483 WP_000139712.1.68489 WP_000139712.1.68504 WP_000139712.1.68505 WP_000139712.1.68512 WP_000139712.1.68522 WP_000139712.1.68548 WP_000139712.1.68565 WP_000139712.1.686 WP_000139712.1.68636 WP_000139712.1.68650 WP_000139712.1.68681 WP_000139712.1.68683 WP_000139712.1.68699 WP_000139712.1.68703 WP_000139712.1.68728 WP_000139712.1.68737 WP_000139712.1.68741 WP_000139712.1.68743 WP_000139712.1.68747 WP_000139712.1.68773 WP_000139712.1.68775 WP_000139712.1.68813 WP_000139712.1.68854 WP_000139712.1.68864 WP_000139712.1.68875 WP_000139712.1.68883 WP_000139712.1.68931 WP_000139712.1.68943 WP_000139712.1.68944 WP_000139712.1.68998 WP_000139712.1.69012 WP_000139712.1.69016 WP_000139712.1.69045 WP_000139712.1.69071 WP_000139712.1.69078 WP_000139712.1.69087 WP_000139712.1.69089 WP_000139712.1.691 WP_000139712.1.69105 WP_000139712.1.69147 WP_000139712.1.6915 WP_000139712.1.69162 WP_000139712.1.6917 WP_000139712.1.69179 WP_000139712.1.69191 WP_000139712.1.69198 WP_000139712.1.69213 WP_000139712.1.69219 WP_000139712.1.69222 WP_000139712.1.69232 WP_000139712.1.69237 WP_000139712.1.69239 WP_000139712.1.69251 WP_000139712.1.69349 WP_000139712.1.69361 WP_000139712.1.69366 WP_000139712.1.69394 WP_000139712.1.69395 WP_000139712.1.69412 WP_000139712.1.69415 WP_000139712.1.69434 WP_000139712.1.69437 WP_000139712.1.69475 WP_000139712.1.69476 WP_000139712.1.69480 WP_000139712.1.69483 WP_000139712.1.69489 WP_000139712.1.69490 WP_000139712.1.695 WP_000139712.1.69520 WP_000139712.1.6953 WP_000139712.1.69546 WP_000139712.1.69552 WP_000139712.1.69563 WP_000139712.1.69598 WP_000139712.1.69622 WP_000139712.1.69639 WP_000139712.1.69679 WP_000139712.1.6968 WP_000139712.1.69683 WP_000139712.1.69721 WP_000139712.1.69724 WP_000139712.1.69734 WP_000139712.1.6980 WP_000139712.1.69820 WP_000139712.1.69823 WP_000139712.1.69830 WP_000139712.1.69877 WP_000139712.1.69878 WP_000139712.1.69882 WP_000139712.1.699 WP_000139712.1.69902 WP_000139712.1.69921 WP_000139712.1.69934 WP_000139712.1.69980 WP_000139712.1.69987 WP_000139712.1.69995 WP_000139712.1.70024 WP_000139712.1.70048 WP_000139712.1.70059 WP_000139712.1.70089 WP_000139712.1.70105 WP_000139712.1.7012 WP_000139712.1.70133 WP_000139712.1.70161 WP_000139712.1.70210 WP_000139712.1.70220 WP_000139712.1.70225 WP_000139712.1.70228 WP_000139712.1.7024 WP_000139712.1.70253 WP_000139712.1.70266 WP_000139712.1.70273 WP_000139712.1.70294 WP_000139712.1.703 WP_000139712.1.70311 WP_000139712.1.70313 WP_000139712.1.70334 WP_000139712.1.7034 WP_000139712.1.70344 WP_000139712.1.70349 WP_000139712.1.70353 WP_000139712.1.7043 WP_000139712.1.70448 WP_000139712.1.70451 WP_000139712.1.70457 WP_000139712.1.70459 WP_000139712.1.7046 WP_000139712.1.70462 WP_000139712.1.70487 WP_000139712.1.70495 WP_000139712.1.70527 WP_000139712.1.7053 WP_000139712.1.70541 WP_000139712.1.70546 WP_000139712.1.70554 WP_000139712.1.70558 WP_000139712.1.70564 WP_000139712.1.7061 WP_000139712.1.70611 WP_000139712.1.70635 WP_000139712.1.7064 WP_000139712.1.70641 WP_000139712.1.70664 WP_000139712.1.7067 WP_000139712.1.70672 WP_000139712.1.707 WP_000139712.1.70721 WP_000139712.1.7073 WP_000139712.1.70763 WP_000139712.1.70808 WP_000139712.1.70818 WP_000139712.1.70823 WP_000139712.1.70829 WP_000139712.1.70835 WP_000139712.1.70843 WP_000139712.1.70850 WP_000139712.1.70855 WP_000139712.1.70909 WP_000139712.1.70924 WP_000139712.1.70926 WP_000139712.1.70930 WP_000139712.1.70939 WP_000139712.1.70943 WP_000139712.1.70994 WP_000139712.1.710 WP_000139712.1.71016 WP_000139712.1.71027 WP_000139712.1.71043 WP_000139712.1.7105 WP_000139712.1.71058 WP_000139712.1.71059 WP_000139712.1.71073 WP_000139712.1.7109 WP_000139712.1.71130 WP_000139712.1.71179 WP_000139712.1.71182 WP_000139712.1.71196 WP_000139712.1.7120 WP_000139712.1.71208 WP_000139712.1.71231 WP_000139712.1.7125 WP_000139712.1.71257 WP_000139712.1.71266 WP_000139712.1.71267 WP_000139712.1.71280 WP_000139712.1.71295 WP_000139712.1.71298 WP_000139712.1.71301 WP_000139712.1.71313 WP_000139712.1.71325 WP_000139712.1.71345 WP_000139712.1.71359 WP_000139712.1.71404 WP_000139712.1.71410 WP_000139712.1.71416 WP_000139712.1.71419 WP_000139712.1.71428 WP_000139712.1.71438 WP_000139712.1.71463 WP_000139712.1.71466 WP_000139712.1.71467 WP_000139712.1.71475 WP_000139712.1.71483 WP_000139712.1.7150 WP_000139712.1.71529 WP_000139712.1.71541 WP_000139712.1.71543 WP_000139712.1.71547 WP_000139712.1.71572 WP_000139712.1.71575 WP_000139712.1.7158 WP_000139712.1.71590 WP_000139712.1.71596 WP_000139712.1.71602 WP_000139712.1.7161 WP_000139712.1.71662 WP_000139712.1.71676 WP_000139712.1.71715 WP_000139712.1.71721 WP_000139712.1.71735 WP_000139712.1.71737 WP_000139712.1.71739 WP_000139712.1.71741 WP_000139712.1.71771 WP_000139712.1.71780 WP_000139712.1.7179 WP_000139712.1.71800 WP_000139712.1.71828 WP_000139712.1.71836 WP_000139712.1.71861 WP_000139712.1.71863 WP_000139712.1.71877 WP_000139712.1.71892 WP_000139712.1.71899 WP_000139712.1.71910 WP_000139712.1.71925 WP_000139712.1.71978 WP_000139712.1.71981 WP_000139712.1.71989 WP_000139712.1.72002 WP_000139712.1.72018 WP_000139712.1.72026 WP_000139712.1.72031 WP_000139712.1.72067 WP_000139712.1.72085 WP_000139712.1.72148 WP_000139712.1.72169 WP_000139712.1.72176 WP_000139712.1.722 WP_000139712.1.72204 WP_000139712.1.72205 WP_000139712.1.72257 WP_000139712.1.72271 WP_000139712.1.72306 WP_000139712.1.72330 WP_000139712.1.72340 WP_000139712.1.72347 WP_000139712.1.7236 WP_000139712.1.72363 WP_000139712.1.72366 WP_000139712.1.72371 WP_000139712.1.72424 WP_000139712.1.72453 WP_000139712.1.72465 WP_000139712.1.72478 WP_000139712.1.72489 WP_000139712.1.72497 WP_000139712.1.72529 WP_000139712.1.7254 WP_000139712.1.72547 WP_000139712.1.72564 WP_000139712.1.7258 WP_000139712.1.7260 WP_000139712.1.72626 WP_000139712.1.72649 WP_000139712.1.72654 WP_000139712.1.72666 WP_000139712.1.72708 WP_000139712.1.72719 WP_000139712.1.72750 WP_000139712.1.72753 WP_000139712.1.72760 WP_000139712.1.72762 WP_000139712.1.72787 WP_000139712.1.72816 WP_000139712.1.72832 WP_000139712.1.72834 WP_000139712.1.72835 WP_000139712.1.72874 WP_000139712.1.72881 WP_000139712.1.72903 WP_000139712.1.72904 WP_000139712.1.72930 WP_000139712.1.72935 WP_000139712.1.7294 WP_000139712.1.72945 WP_000139712.1.72991 WP_000139712.1.73002 WP_000139712.1.73017 WP_000139712.1.73019 WP_000139712.1.73021 WP_000139712.1.73022 WP_000139712.1.73037 WP_000139712.1.73087 WP_000139712.1.73122 WP_000139712.1.73132 WP_000139712.1.73140 WP_000139712.1.73190 WP_000139712.1.73195 WP_000139712.1.73201 WP_000139712.1.73211 WP_000139712.1.73240 WP_000139712.1.73241 WP_000139712.1.73246 WP_000139712.1.73264 WP_000139712.1.73265 WP_000139712.1.73286 WP_000139712.1.73386 WP_000139712.1.73401 WP_000139712.1.73420 WP_000139712.1.73444 WP_000139712.1.73450 WP_000139712.1.73456 WP_000139712.1.73464 WP_000139712.1.73489 WP_000139712.1.73501 WP_000139712.1.73513 WP_000139712.1.73536 WP_000139712.1.73539 WP_000139712.1.73547 WP_000139712.1.73571 WP_000139712.1.73591 WP_000139712.1.736 WP_000139712.1.7360 WP_000139712.1.73610 WP_000139712.1.73639 WP_000139712.1.7365 WP_000139712.1.73685 WP_000139712.1.73687 WP_000139712.1.73693 WP_000139712.1.73694 WP_000139712.1.73735 WP_000139712.1.73740 WP_000139712.1.73759 WP_000139712.1.73786 WP_000139712.1.73789 WP_000139712.1.7380 WP_000139712.1.73834 WP_000139712.1.73837 WP_000139712.1.73858 WP_000139712.1.73868 WP_000139712.1.73885 WP_000139712.1.73900 WP_000139712.1.73910 WP_000139712.1.73920 WP_000139712.1.73921 WP_000139712.1.73940 WP_000139712.1.73949 WP_000139712.1.73961 WP_000139712.1.73969 WP_000139712.1.73971 WP_000139712.1.73976 WP_000139712.1.73983 WP_000139712.1.74004 WP_000139712.1.74006 WP_000139712.1.7401 WP_000139712.1.74010 WP_000139712.1.74025 WP_000139712.1.74027 WP_000139712.1.7406 WP_000139712.1.74073 WP_000139712.1.74081 WP_000139712.1.74085 WP_000139712.1.74088 WP_000139712.1.74155 WP_000139712.1.74157 WP_000139712.1.74161 WP_000139712.1.74172 WP_000139712.1.74173 WP_000139712.1.74183 WP_000139712.1.74216 WP_000139712.1.74234 WP_000139712.1.74237 WP_000139712.1.74257 WP_000139712.1.7427 WP_000139712.1.74273 WP_000139712.1.74284 WP_000139712.1.74295 WP_000139712.1.74327 WP_000139712.1.7434 WP_000139712.1.74353 WP_000139712.1.74356 WP_000139712.1.74380 WP_000139712.1.74456 WP_000139712.1.74457 WP_000139712.1.74468 WP_000139712.1.74533 WP_000139712.1.7457 WP_000139712.1.74576 WP_000139712.1.74587 WP_000139712.1.74610 WP_000139712.1.74638 WP_000139712.1.74645 WP_000139712.1.74676 WP_000139712.1.74681 WP_000139712.1.74693 WP_000139712.1.74696 WP_000139712.1.74704 WP_000139712.1.74731 WP_000139712.1.74747 WP_000139712.1.74758 WP_000139712.1.74761 WP_000139712.1.74770 WP_000139712.1.74785 WP_000139712.1.74797 WP_000139712.1.74802 WP_000139712.1.7482 WP_000139712.1.74840 WP_000139712.1.74866 WP_000139712.1.74874 WP_000139712.1.74890 WP_000139712.1.74911 WP_000139712.1.74922 WP_000139712.1.74924 WP_000139712.1.74961 WP_000139712.1.74978 WP_000139712.1.74985 WP_000139712.1.74994 WP_000139712.1.74999 WP_000139712.1.75038 WP_000139712.1.75044 WP_000139712.1.75048 WP_000139712.1.75052 WP_000139712.1.75070 WP_000139712.1.75093 WP_000139712.1.75111 WP_000139712.1.75131 WP_000139712.1.75132 WP_000139712.1.75141 WP_000139712.1.75186 WP_000139712.1.75227 WP_000139712.1.75252 WP_000139712.1.75253 WP_000139712.1.75294 WP_000139712.1.75298 WP_000139712.1.75320 WP_000139712.1.75323 WP_000139712.1.75327 WP_000139712.1.75349 WP_000139712.1.75351 WP_000139712.1.75356 WP_000139712.1.75365 WP_000139712.1.75379 WP_000139712.1.75399 WP_000139712.1.75409 WP_000139712.1.7542 WP_000139712.1.75438 WP_000139712.1.75440 WP_000139712.1.75521 WP_000139712.1.75527 WP_000139712.1.75538 WP_000139712.1.75551 WP_000139712.1.75566 WP_000139712.1.75571 WP_000139712.1.75590 WP_000139712.1.7561 WP_000139712.1.75647 WP_000139712.1.75649 WP_000139712.1.75652 WP_000139712.1.75685 WP_000139712.1.75692 WP_000139712.1.75704 WP_000139712.1.75728 WP_000139712.1.75743 WP_000139712.1.75769 WP_000139712.1.75775 WP_000139712.1.758 WP_000139712.1.75800 WP_000139712.1.75805 WP_000139712.1.75809 WP_000139712.1.75830 WP_000139712.1.75840 WP_000139712.1.75848 WP_000139712.1.75851 WP_000139712.1.75862 WP_000139712.1.75881 WP_000139712.1.75885 WP_000139712.1.75910 WP_000139712.1.75929 WP_000139712.1.75944 WP_000139712.1.75952 WP_000139712.1.75956 WP_000139712.1.7596 WP_000139712.1.75969 WP_000139712.1.76010 WP_000139712.1.76013 WP_000139712.1.76015 WP_000139712.1.7602 WP_000139712.1.76047 WP_000139712.1.76049 WP_000139712.1.76050 WP_000139712.1.76053 WP_000139712.1.76095 WP_000139712.1.76104 WP_000139712.1.76111 WP_000139712.1.76114 WP_000139712.1.76121 WP_000139712.1.76123 WP_000139712.1.76143 WP_000139712.1.76149 WP_000139712.1.76153 WP_000139712.1.76179 WP_000139712.1.76230 WP_000139712.1.76234 WP_000139712.1.7624 WP_000139712.1.7625 WP_000139712.1.76258 WP_000139712.1.76261 WP_000139712.1.7627 WP_000139712.1.76282 WP_000139712.1.76283 WP_000139712.1.76294 WP_000139712.1.76313 WP_000139712.1.76332 WP_000139712.1.76337 WP_000139712.1.76351 WP_000139712.1.76411 WP_000139712.1.76419 WP_000139712.1.76420 WP_000139712.1.76421 WP_000139712.1.76424 WP_000139712.1.76426 WP_000139712.1.76431 WP_000139712.1.76463 WP_000139712.1.76482 WP_000139712.1.76497 WP_000139712.1.765 WP_000139712.1.76528 WP_000139712.1.7658 WP_000139712.1.76606 WP_000139712.1.76624 WP_000139712.1.76648 WP_000139712.1.76659 WP_000139712.1.76674 WP_000139712.1.76686 WP_000139712.1.76689 WP_000139712.1.76690 WP_000139712.1.76693 WP_000139712.1.76711 WP_000139712.1.76718 WP_000139712.1.7675 WP_000139712.1.76790 WP_000139712.1.76792 WP_000139712.1.76798 WP_000139712.1.768 WP_000139712.1.76803 WP_000139712.1.76816 WP_000139712.1.76820 WP_000139712.1.76825 WP_000139712.1.76829 WP_000139712.1.76839 WP_000139712.1.76845 WP_000139712.1.76869 WP_000139712.1.76878 WP_000139712.1.76895 WP_000139712.1.76897 WP_000139712.1.76921 WP_000139712.1.7694 WP_000139712.1.76944 WP_000139712.1.76952 WP_000139712.1.76998 WP_000139712.1.77020 WP_000139712.1.77031 WP_000139712.1.77041 WP_000139712.1.77043 WP_000139712.1.77050 WP_000139712.1.77060 WP_000139712.1.77062 WP_000139712.1.77072 WP_000139712.1.77112 WP_000139712.1.77137 WP_000139712.1.77144 WP_000139712.1.77145 WP_000139712.1.77158 WP_000139712.1.77187 WP_000139712.1.77190 WP_000139712.1.77203 WP_000139712.1.77229 WP_000139712.1.77256 WP_000139712.1.77297 WP_000139712.1.77298 WP_000139712.1.77305 WP_000139712.1.77331 WP_000139712.1.77346 WP_000139712.1.77359 WP_000139712.1.77388 WP_000139712.1.77426 WP_000139712.1.7746 WP_000139712.1.77460 WP_000139712.1.77485 WP_000139712.1.77489 WP_000139712.1.77497 WP_000139712.1.77498 WP_000139712.1.7752 WP_000139712.1.77520 WP_000139712.1.77527 WP_000139712.1.77532 WP_000139712.1.77533 WP_000139712.1.77536 WP_000139712.1.77572 WP_000139712.1.77583 WP_000139712.1.77603 WP_000139712.1.77606 WP_000139712.1.77650 WP_000139712.1.77733 WP_000139712.1.77735 WP_000139712.1.77738 WP_000139712.1.7774 WP_000139712.1.77743 WP_000139712.1.77763 WP_000139712.1.77791 WP_000139712.1.77818 WP_000139712.1.77822 WP_000139712.1.77848 WP_000139712.1.7785 WP_000139712.1.77858 WP_000139712.1.7786 WP_000139712.1.77860 WP_000139712.1.7787 WP_000139712.1.77882 WP_000139712.1.77883 WP_000139712.1.77915 WP_000139712.1.77922 WP_000139712.1.77930 WP_000139712.1.77952 WP_000139712.1.77957 WP_000139712.1.77986 WP_000139712.1.78038 WP_000139712.1.78054 WP_000139712.1.78082 WP_000139712.1.78091 WP_000139712.1.78093 WP_000139712.1.78095 WP_000139712.1.7810 WP_000139712.1.78173 WP_000139712.1.78179 WP_000139712.1.78189 WP_000139712.1.78194 WP_000139712.1.78207 WP_000139712.1.78252 WP_000139712.1.78254 WP_000139712.1.78257 WP_000139712.1.7827 WP_000139712.1.78311 WP_000139712.1.78324 WP_000139712.1.7833 WP_000139712.1.78330 WP_000139712.1.78332 WP_000139712.1.78335 WP_000139712.1.78365 WP_000139712.1.78371 WP_000139712.1.78392 WP_000139712.1.78404 WP_000139712.1.78434 WP_000139712.1.78436 WP_000139712.1.78470 WP_000139712.1.78489 WP_000139712.1.78494 WP_000139712.1.7850 WP_000139712.1.78513 WP_000139712.1.7853 WP_000139712.1.78558 WP_000139712.1.7857 WP_000139712.1.78573 WP_000139712.1.78585 WP_000139712.1.78592 WP_000139712.1.78598 WP_000139712.1.78604 WP_000139712.1.78638 WP_000139712.1.78653 WP_000139712.1.78662 WP_000139712.1.78667 WP_000139712.1.7868 WP_000139712.1.78685 WP_000139712.1.78708 WP_000139712.1.78728 WP_000139712.1.78731 WP_000139712.1.78736 WP_000139712.1.78758 WP_000139712.1.78763 WP_000139712.1.78803 WP_000139712.1.78816 WP_000139712.1.78819 WP_000139712.1.78841 WP_000139712.1.78897 WP_000139712.1.78920 WP_000139712.1.78937 WP_000139712.1.78978 WP_000139712.1.78983 WP_000139712.1.78985 WP_000139712.1.78991 WP_000139712.1.78995 WP_000139712.1.7900 WP_000139712.1.79006 WP_000139712.1.79038 WP_000139712.1.7905 WP_000139712.1.79051 WP_000139712.1.79059 WP_000139712.1.79085 WP_000139712.1.79110 WP_000139712.1.79131 WP_000139712.1.7914 WP_000139712.1.79143 WP_000139712.1.79156 WP_000139712.1.79170 WP_000139712.1.79178 WP_000139712.1.79192 WP_000139712.1.79197 WP_000139712.1.79208 WP_000139712.1.79223 WP_000139712.1.79227 WP_000139712.1.79270 WP_000139712.1.79275 WP_000139712.1.79285 WP_000139712.1.7931 WP_000139712.1.79310 WP_000139712.1.79314 WP_000139712.1.79322 WP_000139712.1.79332 WP_000139712.1.79341 WP_000139712.1.79367 WP_000139712.1.79374 WP_000139712.1.79378 WP_000139712.1.79379 WP_000139712.1.79400 WP_000139712.1.79402 WP_000139712.1.79408 WP_000139712.1.79436 WP_000139712.1.79452 WP_000139712.1.79461 WP_000139712.1.79476 WP_000139712.1.79539 WP_000139712.1.79552 WP_000139712.1.79556 WP_000139712.1.79581 WP_000139712.1.79626 WP_000139712.1.79627 WP_000139712.1.79638 WP_000139712.1.79662 WP_000139712.1.79664 WP_000139712.1.79676 WP_000139712.1.79677 WP_000139712.1.79706 WP_000139712.1.79731 WP_000139712.1.79737 WP_000139712.1.79763 WP_000139712.1.7981 WP_000139712.1.79815 WP_000139712.1.79822 WP_000139712.1.79831 WP_000139712.1.79834 WP_000139712.1.79837 WP_000139712.1.79854 WP_000139712.1.79855 WP_000139712.1.7989 WP_000139712.1.79896 WP_000139712.1.79904 WP_000139712.1.79911 WP_000139712.1.7992 WP_000139712.1.79941 WP_000139712.1.79949 WP_000139712.1.79961 WP_000139712.1.79971 WP_000139712.1.79991 WP_000139712.1.80000 WP_000139712.1.80009 WP_000139712.1.80013 WP_000139712.1.80029 WP_000139712.1.80032 WP_000139712.1.80042 WP_000139712.1.80079 WP_000139712.1.80086 WP_000139712.1.80109 WP_000139712.1.80119 WP_000139712.1.80120 WP_000139712.1.80122 WP_000139712.1.80127 WP_000139712.1.80152 WP_000139712.1.80181 WP_000139712.1.80184 WP_000139712.1.80203 WP_000139712.1.80206 WP_000139712.1.80210 WP_000139712.1.80244 WP_000139712.1.80274 WP_000139712.1.80286 WP_000139712.1.80287 WP_000139712.1.80290 WP_000139712.1.80297 WP_000139712.1.8030 WP_000139712.1.8031 WP_000139712.1.80316 WP_000139712.1.80317 WP_000139712.1.8035 WP_000139712.1.80358 WP_000139712.1.80361 WP_000139712.1.80378 WP_000139712.1.80389 WP_000139712.1.80393 WP_000139712.1.8040 WP_000139712.1.80407 WP_000139712.1.80414 WP_000139712.1.8043 WP_000139712.1.80434 WP_000139712.1.8045 WP_000139712.1.80472 WP_000139712.1.80521 WP_000139712.1.80530 WP_000139712.1.80582 WP_000139712.1.80647 WP_000139712.1.8065 WP_000139712.1.80653 WP_000139712.1.80687 WP_000139712.1.80717 WP_000139712.1.80734 WP_000139712.1.80745 WP_000139712.1.80761 WP_000139712.1.80762 WP_000139712.1.80763 WP_000139712.1.8077 WP_000139712.1.80781 WP_000139712.1.80786 WP_000139712.1.80833 WP_000139712.1.8084 WP_000139712.1.80845 WP_000139712.1.80855 WP_000139712.1.80872 WP_000139712.1.80899 WP_000139712.1.80962 WP_000139712.1.80972 WP_000139712.1.81010 WP_000139712.1.81022 WP_000139712.1.81049 WP_000139712.1.81052 WP_000139712.1.81064 WP_000139712.1.81065 WP_000139712.1.81085 WP_000139712.1.81095 WP_000139712.1.81097 WP_000139712.1.81114 WP_000139712.1.81132 WP_000139712.1.81151 WP_000139712.1.81157 WP_000139712.1.81171 WP_000139712.1.81172 WP_000139712.1.81176 WP_000139712.1.81184 WP_000139712.1.81214 WP_000139712.1.81224 WP_000139712.1.81228 WP_000139712.1.81232 WP_000139712.1.81234 WP_000139712.1.81243 WP_000139712.1.8125 WP_000139712.1.81252 WP_000139712.1.81288 WP_000139712.1.81290 WP_000139712.1.81344 WP_000139712.1.8135 WP_000139712.1.81379 WP_000139712.1.81384 WP_000139712.1.81385 WP_000139712.1.81387 WP_000139712.1.81389 WP_000139712.1.8142 WP_000139712.1.8144 WP_000139712.1.81464 WP_000139712.1.81467 WP_000139712.1.81508 WP_000139712.1.81532 WP_000139712.1.81574 WP_000139712.1.81599 WP_000139712.1.8160 WP_000139712.1.81604 WP_000139712.1.81610 WP_000139712.1.81619 WP_000139712.1.81645 WP_000139712.1.81718 WP_000139712.1.81738 WP_000139712.1.81740 WP_000139712.1.81758 WP_000139712.1.81767 WP_000139712.1.81789 WP_000139712.1.8180 WP_000139712.1.81800 WP_000139712.1.81810 WP_000139712.1.81812 WP_000139712.1.81829 WP_000139712.1.81831 WP_000139712.1.81837 WP_000139712.1.81838 WP_000139712.1.8185 WP_000139712.1.81861 WP_000139712.1.81870 WP_000139712.1.81897 WP_000139712.1.81903 WP_000139712.1.81905 WP_000139712.1.81906 WP_000139712.1.81919 WP_000139712.1.81944 WP_000139712.1.81955 WP_000139712.1.81969 WP_000139712.1.81982 WP_000139712.1.81990 WP_000139712.1.81999 WP_000139712.1.82009 WP_000139712.1.82017 WP_000139712.1.82053 WP_000139712.1.8206 WP_000139712.1.82103 WP_000139712.1.8212 WP_000139712.1.82121 WP_000139712.1.8213 WP_000139712.1.82174 WP_000139712.1.82184 WP_000139712.1.82219 WP_000139712.1.82234 WP_000139712.1.82247 WP_000139712.1.82253 WP_000139712.1.82259 WP_000139712.1.82278 WP_000139712.1.82281 WP_000139712.1.82301 WP_000139712.1.82315 WP_000139712.1.82340 WP_000139712.1.82349 WP_000139712.1.82354 WP_000139712.1.82358 WP_000139712.1.82368 WP_000139712.1.82406 WP_000139712.1.82441 WP_000139712.1.82447 WP_000139712.1.82455 WP_000139712.1.82458 WP_000139712.1.8246 WP_000139712.1.82467 WP_000139712.1.82468 WP_000139712.1.82525 WP_000139712.1.82535 WP_000139712.1.82548 WP_000139712.1.82558 WP_000139712.1.8261 WP_000139712.1.82612 WP_000139712.1.8265 WP_000139712.1.8266 WP_000139712.1.82664 WP_000139712.1.82678 WP_000139712.1.82709 WP_000139712.1.82724 WP_000139712.1.82768 WP_000139712.1.82775 WP_000139712.1.82796 WP_000139712.1.8280 WP_000139712.1.82802 WP_000139712.1.82824 WP_000139712.1.82829 WP_000139712.1.82855 WP_000139712.1.82862 WP_000139712.1.8288 WP_000139712.1.8289 WP_000139712.1.82930 WP_000139712.1.82941 WP_000139712.1.82976 WP_000139712.1.82980 WP_000139712.1.8302 WP_000139712.1.83021 WP_000139712.1.83046 WP_000139712.1.83054 WP_000139712.1.83066 WP_000139712.1.83078 WP_000139712.1.83086 WP_000139712.1.8310 WP_000139712.1.83103 WP_000139712.1.83152 WP_000139712.1.83153 WP_000139712.1.8318 WP_000139712.1.83185 WP_000139712.1.8319 WP_000139712.1.83193 WP_000139712.1.83203 WP_000139712.1.83234 WP_000139712.1.83250 WP_000139712.1.8328 WP_000139712.1.83291 WP_000139712.1.83316 WP_000139712.1.83352 WP_000139712.1.83359 WP_000139712.1.83372 WP_000139712.1.83405 WP_000139712.1.83417 WP_000139712.1.83418 WP_000139712.1.8346 WP_000139712.1.83467 WP_000139712.1.83468 WP_000139712.1.83472 WP_000139712.1.83476 WP_000139712.1.83479 WP_000139712.1.83484 WP_000139712.1.83508 WP_000139712.1.83517 WP_000139712.1.83520 WP_000139712.1.83553 WP_000139712.1.83593 WP_000139712.1.83597 WP_000139712.1.83624 WP_000139712.1.83646 WP_000139712.1.83652 WP_000139712.1.83653 WP_000139712.1.8366 WP_000139712.1.83674 WP_000139712.1.83676 WP_000139712.1.83720 WP_000139712.1.83728 WP_000139712.1.83750 WP_000139712.1.83756 WP_000139712.1.83758 WP_000139712.1.83763 WP_000139712.1.83769 WP_000139712.1.83770 WP_000139712.1.83775 WP_000139712.1.83788 WP_000139712.1.83792 WP_000139712.1.83797 WP_000139712.1.83804 WP_000139712.1.83816 WP_000139712.1.83825 WP_000139712.1.8383 WP_000139712.1.83844 WP_000139712.1.8385 WP_000139712.1.83864 WP_000139712.1.83865 WP_000139712.1.83868 WP_000139712.1.83881 WP_000139712.1.83886 WP_000139712.1.83905 WP_000139712.1.83912 WP_000139712.1.83919 WP_000139712.1.83928 WP_000139712.1.83955 WP_000139712.1.83984 WP_000139712.1.83989 WP_000139712.1.84025 WP_000139712.1.84049 WP_000139712.1.84054 WP_000139712.1.84064 WP_000139712.1.84118 WP_000139712.1.84129 WP_000139712.1.84144 WP_000139712.1.84163 WP_000139712.1.84188 WP_000139712.1.84194 WP_000139712.1.84275 WP_000139712.1.84293 WP_000139712.1.8432 WP_000139712.1.84415 WP_000139712.1.84418 WP_000139712.1.84442 WP_000139712.1.84445 WP_000139712.1.84451 WP_000139712.1.84508 WP_000139712.1.84509 WP_000139712.1.84563 WP_000139712.1.84578 WP_000139712.1.84590 WP_000139712.1.84596 WP_000139712.1.84608 WP_000139712.1.8462 WP_000139712.1.84625 WP_000139712.1.84638 WP_000139712.1.84648 WP_000139712.1.84651 WP_000139712.1.84673 WP_000139712.1.84679 WP_000139712.1.8468 WP_000139712.1.84682 WP_000139712.1.84696 WP_000139712.1.84714 WP_000139712.1.84736 WP_000139712.1.8475 WP_000139712.1.84752 WP_000139712.1.84757 WP_000139712.1.84761 WP_000139712.1.84815 WP_000139712.1.84826 WP_000139712.1.84844 WP_000139712.1.84847 WP_000139712.1.84854 WP_000139712.1.84874 WP_000139712.1.84889 WP_000139712.1.84903 WP_000139712.1.84907 WP_000139712.1.84922 WP_000139712.1.84924 WP_000139712.1.8493 WP_000139712.1.84943 WP_000139712.1.84951 WP_000139712.1.8496 WP_000139712.1.84975 WP_000139712.1.84978 WP_000139712.1.85017 WP_000139712.1.85022 WP_000139712.1.85026 WP_000139712.1.85045 WP_000139712.1.85047 WP_000139712.1.85056 WP_000139712.1.85070 WP_000139712.1.85081 WP_000139712.1.85099 WP_000139712.1.85118 WP_000139712.1.85132 WP_000139712.1.85133 WP_000139712.1.85135 WP_000139712.1.85144 WP_000139712.1.85151 WP_000139712.1.85160 WP_000139712.1.85198 WP_000139712.1.85213 WP_000139712.1.85226 WP_000139712.1.85229 WP_000139712.1.85231 WP_000139712.1.85235 WP_000139712.1.85238 WP_000139712.1.85265 WP_000139712.1.85289 WP_000139712.1.85292 WP_000139712.1.85302 WP_000139712.1.85331 WP_000139712.1.85351 WP_000139712.1.85354 WP_000139712.1.85375 WP_000139712.1.85376 WP_000139712.1.85383 WP_000139712.1.85391 WP_000139712.1.85395 WP_000139712.1.85401 WP_000139712.1.85404 WP_000139712.1.85409 WP_000139712.1.85425 WP_000139712.1.85440 WP_000139712.1.85441 WP_000139712.1.85445 WP_000139712.1.85462 WP_000139712.1.85471 WP_000139712.1.85474 WP_000139712.1.85485 WP_000139712.1.85492 WP_000139712.1.85506 WP_000139712.1.8551 WP_000139712.1.85515 WP_000139712.1.85519 WP_000139712.1.85547 WP_000139712.1.85549 WP_000139712.1.85555 WP_000139712.1.85562 WP_000139712.1.85585 WP_000139712.1.85586 WP_000139712.1.85596 WP_000139712.1.85634 WP_000139712.1.85649 WP_000139712.1.8572 WP_000139712.1.85730 WP_000139712.1.85732 WP_000139712.1.85758 WP_000139712.1.8576 WP_000139712.1.85795 WP_000139712.1.85796 WP_000139712.1.85816 WP_000139712.1.85834 WP_000139712.1.85858 WP_000139712.1.85873 WP_000139712.1.85906 WP_000139712.1.85924 WP_000139712.1.85927 WP_000139712.1.85950 WP_000139712.1.85971 WP_000139712.1.85980 WP_000139712.1.85989 WP_000139712.1.85993 WP_000139712.1.86018 WP_000139712.1.86036 WP_000139712.1.86042 WP_000139712.1.86072 WP_000139712.1.86086 WP_000139712.1.8609 WP_000139712.1.86123 WP_000139712.1.86136 WP_000139712.1.86144 WP_000139712.1.86153 WP_000139712.1.86154 WP_000139712.1.86158 WP_000139712.1.8617 WP_000139712.1.86188 WP_000139712.1.86197 WP_000139712.1.862 WP_000139712.1.86207 WP_000139712.1.86209 WP_000139712.1.86248 WP_000139712.1.8627 WP_000139712.1.86270 WP_000139712.1.86281 WP_000139712.1.86304 WP_000139712.1.86315 WP_000139712.1.86331 WP_000139712.1.86344 WP_000139712.1.8636 WP_000139712.1.86363 WP_000139712.1.86367 WP_000139712.1.86378 WP_000139712.1.86390 WP_000139712.1.8641 WP_000139712.1.8643 WP_000139712.1.86455 WP_000139712.1.86473 WP_000139712.1.86482 WP_000139712.1.86523 WP_000139712.1.86526 WP_000139712.1.86531 WP_000139712.1.86542 WP_000139712.1.86606 WP_000139712.1.86628 WP_000139712.1.8663 WP_000139712.1.86664 WP_000139712.1.86704 WP_000139712.1.86706 WP_000139712.1.86736 WP_000139712.1.86745 WP_000139712.1.86779 WP_000139712.1.86792 WP_000139712.1.86793 WP_000139712.1.86795 WP_000139712.1.8681 WP_000139712.1.86838 WP_000139712.1.86881 WP_000139712.1.8690 WP_000139712.1.86910 WP_000139712.1.86911 WP_000139712.1.86916 WP_000139712.1.86940 WP_000139712.1.86942 WP_000139712.1.86961 WP_000139712.1.86968 WP_000139712.1.86977 WP_000139712.1.86999 WP_000139712.1.87021 WP_000139712.1.87042 WP_000139712.1.87057 WP_000139712.1.87072 WP_000139712.1.87088 WP_000139712.1.87090 WP_000139712.1.87100 WP_000139712.1.87119 WP_000139712.1.8712 WP_000139712.1.87133 WP_000139712.1.87137 WP_000139712.1.87141 WP_000139712.1.87168 WP_000139712.1.87175 WP_000139712.1.87190 WP_000139712.1.87194 WP_000139712.1.8720 WP_000139712.1.87204 WP_000139712.1.87236 WP_000139712.1.87260 WP_000139712.1.87261 WP_000139712.1.87264 WP_000139712.1.87272 WP_000139712.1.87285 WP_000139712.1.87290 WP_000139712.1.87296 WP_000139712.1.8731 WP_000139712.1.87363 WP_000139712.1.87372 WP_000139712.1.87388 WP_000139712.1.87396 WP_000139712.1.87457 WP_000139712.1.87461 WP_000139712.1.87466 WP_000139712.1.87486 WP_000139712.1.875 WP_000139712.1.87508 WP_000139712.1.87511 WP_000139712.1.87515 WP_000139712.1.8753 WP_000139712.1.87534 WP_000139712.1.87541 WP_000139712.1.87543 WP_000139712.1.87593 WP_000139712.1.87595 WP_000139712.1.87601 WP_000139712.1.87636 WP_000139712.1.8764 WP_000139712.1.87682 WP_000139712.1.8770 WP_000139712.1.87710 WP_000139712.1.87718 WP_000139712.1.87734 WP_000139712.1.87745 WP_000139712.1.87748 WP_000139712.1.87764 WP_000139712.1.8779 WP_000139712.1.87808 WP_000139712.1.87828 WP_000139712.1.87838 WP_000139712.1.87841 WP_000139712.1.87854 WP_000139712.1.87879 WP_000139712.1.8791 WP_000139712.1.87912 WP_000139712.1.87937 WP_000139712.1.87948 WP_000139712.1.87963 WP_000139712.1.87964 WP_000139712.1.87967 WP_000139712.1.87972 WP_000139712.1.87995 WP_000139712.1.88013 WP_000139712.1.88032 WP_000139712.1.88061 WP_000139712.1.88114 WP_000139712.1.88150 WP_000139712.1.88169 WP_000139712.1.88212 WP_000139712.1.88270 WP_000139712.1.88309 WP_000139712.1.88311 WP_000139712.1.88317 WP_000139712.1.88319 WP_000139712.1.88339 WP_000139712.1.88351 WP_000139712.1.88367 WP_000139712.1.88371 WP_000139712.1.88373 WP_000139712.1.88375 WP_000139712.1.88380 WP_000139712.1.88418 WP_000139712.1.88430 WP_000139712.1.88440 WP_000139712.1.88445 WP_000139712.1.88449 WP_000139712.1.8847 WP_000139712.1.88480 WP_000139712.1.88498 WP_000139712.1.88504 WP_000139712.1.88518 WP_000139712.1.88555 WP_000139712.1.88558 WP_000139712.1.88560 WP_000139712.1.88563 WP_000139712.1.8857 WP_000139712.1.88572 WP_000139712.1.88580 WP_000139712.1.88583 WP_000139712.1.88585 WP_000139712.1.8859 WP_000139712.1.88599 WP_000139712.1.88600 WP_000139712.1.88614 WP_000139712.1.88623 WP_000139712.1.88636 WP_000139712.1.88638 WP_000139712.1.88642 WP_000139712.1.88671 WP_000139712.1.88694 WP_000139712.1.88696 WP_000139712.1.8872 WP_000139712.1.88739 WP_000139712.1.88753 WP_000139712.1.8877 WP_000139712.1.88771 WP_000139712.1.88781 WP_000139712.1.88843 WP_000139712.1.88856 WP_000139712.1.88859 WP_000139712.1.8886 WP_000139712.1.88878 WP_000139712.1.8888 WP_000139712.1.88881 WP_000139712.1.88897 WP_000139712.1.88922 WP_000139712.1.88934 WP_000139712.1.88954 WP_000139712.1.88960 WP_000139712.1.88962 WP_000139712.1.88987 WP_000139712.1.8899 WP_000139712.1.8900 WP_000139712.1.89012 WP_000139712.1.89024 WP_000139712.1.89027 WP_000139712.1.89036 WP_000139712.1.89070 WP_000139712.1.89086 WP_000139712.1.89108 WP_000139712.1.89125 WP_000139712.1.8913 WP_000139712.1.89133 WP_000139712.1.89139 WP_000139712.1.89164 WP_000139712.1.8918 WP_000139712.1.89181 WP_000139712.1.89184 WP_000139712.1.89194 WP_000139712.1.89195 WP_000139712.1.89204 WP_000139712.1.89216 WP_000139712.1.89235 WP_000139712.1.8924 WP_000139712.1.89258 WP_000139712.1.89262 WP_000139712.1.89284 WP_000139712.1.89290 WP_000139712.1.89348 WP_000139712.1.89350 WP_000139712.1.89372 WP_000139712.1.89390 WP_000139712.1.89404 WP_000139712.1.89433 WP_000139712.1.89476 WP_000139712.1.8950 WP_000139712.1.89516 WP_000139712.1.89537 WP_000139712.1.89544 WP_000139712.1.89545 WP_000139712.1.89556 WP_000139712.1.89557 WP_000139712.1.89559 WP_000139712.1.89603 WP_000139712.1.89655 WP_000139712.1.89672 WP_000139712.1.89678 WP_000139712.1.89686 WP_000139712.1.897 WP_000139712.1.89726 WP_000139712.1.89730 WP_000139712.1.89754 WP_000139712.1.89779 WP_000139712.1.89794 WP_000139712.1.89799 WP_000139712.1.898 WP_000139712.1.89857 WP_000139712.1.8986 WP_000139712.1.89863 WP_000139712.1.89883 WP_000139712.1.89908 WP_000139712.1.89924 WP_000139712.1.89933 WP_000139712.1.89935 WP_000139712.1.89949 WP_000139712.1.89950 WP_000139712.1.89960 WP_000139712.1.90005 WP_000139712.1.90018 WP_000139712.1.90038 WP_000139712.1.90046 WP_000139712.1.90055 WP_000139712.1.90069 WP_000139712.1.90091 WP_000139712.1.90095 WP_000139712.1.90112 WP_000139712.1.90131 WP_000139712.1.90145 WP_000139712.1.90148 WP_000139712.1.90161 WP_000139712.1.90173 WP_000139712.1.90174 WP_000139712.1.90180 WP_000139712.1.90215 WP_000139712.1.90217 WP_000139712.1.9022 WP_000139712.1.90232 WP_000139712.1.90243 WP_000139712.1.90246 WP_000139712.1.90250 WP_000139712.1.90253 WP_000139712.1.90276 WP_000139712.1.90307 WP_000139712.1.90331 WP_000139712.1.90345 WP_000139712.1.90367 WP_000139712.1.90370 WP_000139712.1.90386 WP_000139712.1.90432 WP_000139712.1.90447 WP_000139712.1.90454 WP_000139712.1.90473 WP_000139712.1.90488 WP_000139712.1.90506 WP_000139712.1.90517 WP_000139712.1.90533 WP_000139712.1.90544 WP_000139712.1.9055 WP_000139712.1.90554 WP_000139712.1.90556 WP_000139712.1.90604 WP_000139712.1.90647 WP_000139712.1.90660 WP_000139712.1.90661 WP_000139712.1.90683 WP_000139712.1.90698 WP_000139712.1.9071 WP_000139712.1.90717 WP_000139712.1.90726 WP_000139712.1.90728 WP_000139712.1.90738 WP_000139712.1.90740 WP_000139712.1.90745 WP_000139712.1.90757 WP_000139712.1.9076 WP_000139712.1.90801 WP_000139712.1.90804 WP_000139712.1.90820 WP_000139712.1.90861 WP_000139712.1.90896 WP_000139712.1.90903 WP_000139712.1.90923 WP_000139712.1.9100 WP_000139712.1.91005 WP_000139712.1.91011 WP_000139712.1.91019 WP_000139712.1.91054 WP_000139712.1.91087 WP_000139712.1.91124 WP_000139712.1.91126 WP_000139712.1.9114 WP_000139712.1.91150 WP_000139712.1.91158 WP_000139712.1.91177 WP_000139712.1.912 WP_000139712.1.9122 WP_000139712.1.91233 WP_000139712.1.91246 WP_000139712.1.91252 WP_000139712.1.91258 WP_000139712.1.91279 WP_000139712.1.91280 WP_000139712.1.91287 WP_000139712.1.91297 WP_000139712.1.91300 WP_000139712.1.91332 WP_000139712.1.91346 WP_000139712.1.91357 WP_000139712.1.91364 WP_000139712.1.91365 WP_000139712.1.91371 WP_000139712.1.91382 WP_000139712.1.9140 WP_000139712.1.91420 WP_000139712.1.91427 WP_000139712.1.91447 WP_000139712.1.91486 WP_000139712.1.91487 WP_000139712.1.91500 WP_000139712.1.91525 WP_000139712.1.9153 WP_000139712.1.91530 WP_000139712.1.9155 WP_000139712.1.91559 WP_000139712.1.91573 WP_000139712.1.91581 WP_000139712.1.91586 WP_000139712.1.91587 WP_000139712.1.91611 WP_000139712.1.91624 WP_000139712.1.91634 WP_000139712.1.91639 WP_000139712.1.91660 WP_000139712.1.91670 WP_000139712.1.917 WP_000139712.1.91704 WP_000139712.1.91745 WP_000139712.1.91746 WP_000139712.1.91749 WP_000139712.1.91771 WP_000139712.1.91791 WP_000139712.1.91800 WP_000139712.1.91829 WP_000139712.1.91848 WP_000139712.1.91895 WP_000139712.1.91909 WP_000139712.1.91918 WP_000139712.1.91919 WP_000139712.1.91928 WP_000139712.1.91950 WP_000139712.1.91969 WP_000139712.1.92 WP_000139712.1.92055 WP_000139712.1.92080 WP_000139712.1.92115 WP_000139712.1.92125 WP_000139712.1.92133 WP_000139712.1.92140 WP_000139712.1.92147 WP_000139712.1.92164 WP_000139712.1.92169 WP_000139712.1.92173 WP_000139712.1.92185 WP_000139712.1.92186 WP_000139712.1.92196 WP_000139712.1.92212 WP_000139712.1.92227 WP_000139712.1.92228 WP_000139712.1.9224 WP_000139712.1.92244 WP_000139712.1.92249 WP_000139712.1.92253 WP_000139712.1.92254 WP_000139712.1.92297 WP_000139712.1.923 WP_000139712.1.92303 WP_000139712.1.9234 WP_000139712.1.9237 WP_000139712.1.9239 WP_000139712.1.92391 WP_000139712.1.92398 WP_000139712.1.92405 WP_000139712.1.92415 WP_000139712.1.92425 WP_000139712.1.92436 WP_000139712.1.92442 WP_000139712.1.9247 WP_000139712.1.92479 WP_000139712.1.92488 WP_000139712.1.92497 WP_000139712.1.92500 WP_000139712.1.92512 WP_000139712.1.92520 WP_000139712.1.92534 WP_000139712.1.92541 WP_000139712.1.92546 WP_000139712.1.92565 WP_000139712.1.92602 WP_000139712.1.92667 WP_000139712.1.92674 WP_000139712.1.92679 WP_000139712.1.92688 WP_000139712.1.92691 WP_000139712.1.92718 WP_000139712.1.92723 WP_000139712.1.92735 WP_000139712.1.92741 WP_000139712.1.92765 WP_000139712.1.92778 WP_000139712.1.92789 WP_000139712.1.92795 WP_000139712.1.92805 WP_000139712.1.92848 WP_000139712.1.9286 WP_000139712.1.92862 WP_000139712.1.92864 WP_000139712.1.92918 WP_000139712.1.9293 WP_000139712.1.92937 WP_000139712.1.92950 WP_000139712.1.9296 WP_000139712.1.92960 WP_000139712.1.92965 WP_000139712.1.92997 WP_000139712.1.93010 WP_000139712.1.93047 WP_000139712.1.9305 WP_000139712.1.93071 WP_000139712.1.93074 WP_000139712.1.93125 WP_000139712.1.93141 WP_000139712.1.93147 WP_000139712.1.93163 WP_000139712.1.93176 WP_000139712.1.93191 WP_000139712.1.93197 WP_000139712.1.93198 WP_000139712.1.93207 WP_000139712.1.93211 WP_000139712.1.93224 WP_000139712.1.93231 WP_000139712.1.93243 WP_000139712.1.93254 WP_000139712.1.93260 WP_000139712.1.93263 WP_000139712.1.93272 WP_000139712.1.93296 WP_000139712.1.9330 WP_000139712.1.93300 WP_000139712.1.93310 WP_000139712.1.93336 WP_000139712.1.93374 WP_000139712.1.93378 WP_000139712.1.93416 WP_000139712.1.93438 WP_000139712.1.93444 WP_000139712.1.93471 WP_000139712.1.93514 WP_000139712.1.9352 WP_000139712.1.93538 WP_000139712.1.9354 WP_000139712.1.93567 WP_000139712.1.93579 WP_000139712.1.9358 WP_000139712.1.93590 WP_000139712.1.93613 WP_000139712.1.93647 WP_000139712.1.93658 WP_000139712.1.93669 WP_000139712.1.93678 WP_000139712.1.93708 WP_000139712.1.93710 WP_000139712.1.93722 WP_000139712.1.93736 WP_000139712.1.93738 WP_000139712.1.93758 WP_000139712.1.93762 WP_000139712.1.93769 WP_000139712.1.93775 WP_000139712.1.93787 WP_000139712.1.9387 WP_000139712.1.93882 WP_000139712.1.93883 WP_000139712.1.93890 WP_000139712.1.93891 WP_000139712.1.93975 WP_000139712.1.93976 WP_000139712.1.9398 WP_000139712.1.93981 WP_000139712.1.94 WP_000139712.1.94053 WP_000139712.1.94074 WP_000139712.1.9408 WP_000139712.1.94080 WP_000139712.1.94082 WP_000139712.1.94087 WP_000139712.1.94093 WP_000139712.1.94096 WP_000139712.1.9411 WP_000139712.1.94119 WP_000139712.1.94122 WP_000139712.1.94123 WP_000139712.1.94130 WP_000139712.1.94165 WP_000139712.1.94172 WP_000139712.1.94182 WP_000139712.1.94229 WP_000139712.1.94242 WP_000139712.1.94245 WP_000139712.1.94248 WP_000139712.1.94268 WP_000139712.1.94287 WP_000139712.1.94293 WP_000139712.1.94294 WP_000139712.1.9430 WP_000139712.1.94320 WP_000139712.1.94324 WP_000139712.1.94335 WP_000139712.1.94337 WP_000139712.1.94340 WP_000139712.1.94341 WP_000139712.1.9437 WP_000139712.1.94374 WP_000139712.1.94375 WP_000139712.1.94376 WP_000139712.1.94389 WP_000139712.1.94407 WP_000139712.1.94414 WP_000139712.1.94423 WP_000139712.1.94484 WP_000139712.1.94505 WP_000139712.1.94530 WP_000139712.1.94536 WP_000139712.1.9455 WP_000139712.1.94550 WP_000139712.1.94576 WP_000139712.1.94625 WP_000139712.1.9464 WP_000139712.1.94688 WP_000139712.1.947 WP_000139712.1.94719 WP_000139712.1.94733 WP_000139712.1.94741 WP_000139712.1.94789 WP_000139712.1.94797 WP_000139712.1.94825 WP_000139712.1.94844 WP_000139712.1.94845 WP_000139712.1.9485 WP_000139712.1.94857 WP_000139712.1.94866 WP_000139712.1.94969 WP_000139712.1.9497 WP_000139712.1.94980 WP_000139712.1.94989 WP_000139712.1.94999 WP_000139712.1.95002 WP_000139712.1.95023 WP_000139712.1.95029 WP_000139712.1.95033 WP_000139712.1.95038 WP_000139712.1.95075 WP_000139712.1.95077 WP_000139712.1.9510 WP_000139712.1.95120 WP_000139712.1.95156 WP_000139712.1.95193 WP_000139712.1.95210 WP_000139712.1.95263 WP_000139712.1.95281 WP_000139712.1.95294 WP_000139712.1.95318 WP_000139712.1.95327 WP_000139712.1.95342 WP_000139712.1.95361 WP_000139712.1.95372 WP_000139712.1.9538 WP_000139712.1.95386 WP_000139712.1.95415 WP_000139712.1.9544 WP_000139712.1.95442 WP_000139712.1.95476 WP_000139712.1.95494 WP_000139712.1.95512 WP_000139712.1.95519 WP_000139712.1.95522 WP_000139712.1.95535 WP_000139712.1.95537 WP_000139712.1.95552 WP_000139712.1.95560 WP_000139712.1.95571 WP_000139712.1.95581 WP_000139712.1.95603 WP_000139712.1.9563 WP_000139712.1.95631 WP_000139712.1.95639 WP_000139712.1.95640 WP_000139712.1.95681 WP_000139712.1.95683 WP_000139712.1.95699 WP_000139712.1.95704 WP_000139712.1.95713 WP_000139712.1.95714 WP_000139712.1.95737 WP_000139712.1.95760 WP_000139712.1.95780 WP_000139712.1.95804 WP_000139712.1.95806 WP_000139712.1.95832 WP_000139712.1.95877 WP_000139712.1.95885 WP_000139712.1.959 WP_000139712.1.95914 WP_000139712.1.95918 WP_000139712.1.95962 WP_000139712.1.95986 WP_000139712.1.95997 WP_000139712.1.96014 WP_000139712.1.96022 WP_000139712.1.96030 WP_000139712.1.96056 WP_000139712.1.96057 WP_000139712.1.96067 WP_000139712.1.96075 WP_000139712.1.96105 WP_000139712.1.96135 WP_000139712.1.96148 WP_000139712.1.96160 WP_000139712.1.96163 WP_000139712.1.96165 WP_000139712.1.9617 WP_000139712.1.96209 WP_000139712.1.96218 WP_000139712.1.96228 WP_000139712.1.96255 WP_000139712.1.96271 WP_000139712.1.96280 WP_000139712.1.96283 WP_000139712.1.96297 WP_000139712.1.96305 WP_000139712.1.96312 WP_000139712.1.96314 WP_000139712.1.96316 WP_000139712.1.96322 WP_000139712.1.96334 WP_000139712.1.96362 WP_000139712.1.96364 WP_000139712.1.96424 WP_000139712.1.96433 WP_000139712.1.96468 WP_000139712.1.96472 WP_000139712.1.96474 WP_000139712.1.96477 WP_000139712.1.96489 WP_000139712.1.9650 WP_000139712.1.96535 WP_000139712.1.96538 WP_000139712.1.96554 WP_000139712.1.96566 WP_000139712.1.96568 WP_000139712.1.96578 WP_000139712.1.96591 WP_000139712.1.96603 WP_000139712.1.96628 WP_000139712.1.96634 WP_000139712.1.96637 WP_000139712.1.96638 WP_000139712.1.96646 WP_000139712.1.96654 WP_000139712.1.96663 WP_000139712.1.96678 WP_000139712.1.96682 WP_000139712.1.96688 WP_000139712.1.96699 WP_000139712.1.96705 WP_000139712.1.96718 WP_000139712.1.96727 WP_000139712.1.9675 WP_000139712.1.96770 WP_000139712.1.96780 WP_000139712.1.96804 WP_000139712.1.96836 WP_000139712.1.96854 WP_000139712.1.96855 WP_000139712.1.96859 WP_000139712.1.96882 WP_000139712.1.96892 WP_000139712.1.96895 WP_000139712.1.96918 WP_000139712.1.96922 WP_000139712.1.96928 WP_000139712.1.9695 WP_000139712.1.96956 WP_000139712.1.96965 WP_000139712.1.96969 WP_000139712.1.96970 WP_000139712.1.96976 WP_000139712.1.96985 WP_000139712.1.96997 WP_000139712.1.97000 WP_000139712.1.97001 WP_000139712.1.97004 WP_000139712.1.97007 WP_000139712.1.97014 WP_000139712.1.97017 WP_000139712.1.97019 WP_000139712.1.97029 WP_000139712.1.97033 WP_000139712.1.97034 WP_000139712.1.97072 WP_000139712.1.97117 WP_000139712.1.97138 WP_000139712.1.97139 WP_000139712.1.97141 WP_000139712.1.97146 WP_000139712.1.97161 WP_000139712.1.97164 WP_000139712.1.97191 WP_000139712.1.97205 WP_000139712.1.97228 WP_000139712.1.97230 WP_000139712.1.97241 WP_000139712.1.97267 WP_000139712.1.97295 WP_000139712.1.97302 WP_000139712.1.97336 WP_000139712.1.97348 WP_000139712.1.97352 WP_000139712.1.97355 WP_000139712.1.97367 WP_000139712.1.9737 WP_000139712.1.97392 WP_000139712.1.97409 WP_000139712.1.97411 WP_000139712.1.97427 WP_000139712.1.9743 WP_000139712.1.97444 WP_000139712.1.97450 WP_000139712.1.97456 WP_000139712.1.97460 WP_000139712.1.97466 WP_000139712.1.97468 WP_000139712.1.9748 WP_000139712.1.97484 WP_000139712.1.97494 WP_000139712.1.97530 WP_000139712.1.97531 WP_000139712.1.97536 WP_000139712.1.97537 WP_000139712.1.97574 WP_000139712.1.97575 WP_000139712.1.97576 WP_000139712.1.9758 WP_000139712.1.97585 WP_000139712.1.97627 WP_000139712.1.97641 WP_000139712.1.97664 WP_000139712.1.97687 WP_000139712.1.97696 WP_000139712.1.97699 WP_000139712.1.97717 WP_000139712.1.97720 WP_000139712.1.97729 WP_000139712.1.97731 WP_000139712.1.97739 WP_000139712.1.97742 WP_000139712.1.97744 WP_000139712.1.97746 WP_000139712.1.97758 WP_000139712.1.97762 WP_000139712.1.97786 WP_000139712.1.97827 WP_000139712.1.97835 WP_000139712.1.9788 WP_000139712.1.9789 WP_000139712.1.97899 WP_000139712.1.97928 WP_000139712.1.97935 WP_000139712.1.97953 WP_000139712.1.97955 WP_000139712.1.97967 WP_000139712.1.97974 WP_000139712.1.97997 WP_000139712.1.97999 WP_000139712.1.98011 WP_000139712.1.98033 WP_000139712.1.98051 WP_000139712.1.98054 WP_000139712.1.98058 WP_000139712.1.98073 WP_000139712.1.98131 WP_000139712.1.98161 WP_000139712.1.98174 WP_000139712.1.98179 WP_000139712.1.98195 WP_000139712.1.98233 WP_000139712.1.98242 WP_000139712.1.98248 WP_000139712.1.98249 WP_000139712.1.98281 WP_000139712.1.98295 WP_000139712.1.98307 WP_000139712.1.98328 WP_000139712.1.98352 WP_000139712.1.98353 WP_000139712.1.98360 WP_000139712.1.98361 WP_000139712.1.98366 WP_000139712.1.98379 WP_000139712.1.98387 WP_000139712.1.98409 WP_000139712.1.98411 WP_000139712.1.98415 WP_000139712.1.98425 WP_000139712.1.98456 WP_000139712.1.98497 WP_000139712.1.98512 WP_000139712.1.98548 WP_000139712.1.98552 WP_000139712.1.98559 WP_000139712.1.98585 WP_000139712.1.986 WP_000139712.1.98609 WP_000139712.1.98655 WP_000139712.1.98659 WP_000139712.1.98667 WP_000139712.1.98706 WP_000139712.1.98710 WP_000139712.1.9872 WP_000139712.1.98723 WP_000139712.1.98730 WP_000139712.1.98734 WP_000139712.1.98741 WP_000139712.1.98750 WP_000139712.1.98767 WP_000139712.1.98805 WP_000139712.1.98807 WP_000139712.1.98821 WP_000139712.1.98837 WP_000139712.1.98842 WP_000139712.1.98858 WP_000139712.1.98874 WP_000139712.1.98880 WP_000139712.1.98883 WP_000139712.1.98894 WP_000139712.1.98912 WP_000139712.1.98967 WP_000139712.1.98978 WP_000139712.1.98981 WP_000139712.1.98985 WP_000139712.1.99009 WP_000139712.1.99025 WP_000139712.1.99027 WP_000139712.1.9903 WP_000139712.1.99081 WP_000139712.1.991 WP_000139712.1.9910 WP_000139712.1.9912 WP_000139712.1.99136 WP_000139712.1.99155 WP_000139712.1.99171 WP_000139712.1.99174 WP_000139712.1.99207 WP_000139712.1.99217 WP_000139712.1.99228 WP_000139712.1.99237 WP_000139712.1.99249 WP_000139712.1.99280 WP_000139712.1.99283 WP_000139712.1.99308 WP_000139712.1.99311 WP_000139712.1.99331 WP_000139712.1.99359 WP_000139712.1.9936 WP_000139712.1.99405 WP_000139712.1.99414 WP_000139712.1.99418 WP_000139712.1.99430 WP_000139712.1.99459 WP_000139712.1.99492 WP_000139712.1.99494 WP_000139712.1.99509 WP_000139712.1.99519 WP_000139712.1.99523 WP_000139712.1.99536 WP_000139712.1.99538 WP_000139712.1.99564 WP_000139712.1.99569 WP_000139712.1.9960 WP_000139712.1.99631 WP_000139712.1.99638 WP_000139712.1.9965 WP_000139712.1.99683 WP_000139712.1.99686 WP_000139712.1.99700 WP_000139712.1.9974 WP_000139712.1.99759 WP_000139712.1.99802 WP_000139712.1.99830 WP_000139712.1.99849 WP_000139712.1.99850 WP_000139712.1.99859 WP_000139712.1.99860 WP_000139712.1.9987 WP_000139712.1.99884 WP_000139712.1.99888 WP_000139712.1.99901 WP_000139712.1.99926 WP_000139712.1.99934 WP_000139712.1.99954 WP_000139712.1.99955 WP_000139712.1.99956 WP_000139712.1.99979 WP_000139712.1.99984 WP_000139712.1.99985 WP_000139712.1.99999 YP_499649.1.76163 gi|384869682|ref|YP_005752396.1| gi|148267641|ref|YP_001246584.1| gi|554643942|ref|YP_008715733.1| gi|21282761|ref|NP_645849.1| gi|470222565|ref|YP_007621122.1| gi|151221274|ref|YP_001332096.1| gi|537460819|ref|YP_008491259.1| gi|57650259|ref|YP_186023.1| gi|387150290|ref|YP_005741854.1| gi|49485987|ref|YP_043208.1| gi|521212233|ref|YP_008168579.1| gi|470191111|ref|YP_007577421.1| gi|470224532|ref|YP_007623111.1| gi|384549908|ref|YP_005739160.1| gi|387780261|ref|YP_005755059.1| gi|87161509|ref|YP_493746.1| gi|470195041|ref|YP_007581393.1| gi|470193077|ref|YP_007579430.1| gi|57634627|ref|NP_371673.2| gi|470197007|ref|YP_007583408.1| 158878.SAV1149 158879.SA0996 196620.MW1032 273036.SAB1013 282459.SAS1083 359786.SaurJH9_1208 359787.SaurJH1_1230 418127.SAHV_1140 426430.NWMN_1062 451515.SAUSA300_1048 451516.USA300HOU_1085 681288.SAAV_1117 93061.SAOUHSC_01105 93062.SACOL1160 gi|384861743|ref|YP_005744463.1| gi|269202762|ref|YP_003282031.1| gi|385781377|ref|YP_005757548.1| gi|161509324|ref|YP_001574983.1| gi|379020856|ref|YP_005297518.1| gi|404478488|ref|YP_006709918.1| gi|387602421|ref|YP_005733942.1| gi|384864375|ref|YP_005749734.1| gi|470218744|ref|YP_007619138.1| IDP00615 gi|479329060|ref|YP_007868119.1| gi|545634561|ref|YP_008585131.1| gi|156979471|ref|YP_001441730.1| gi|537442481|ref|YP_008485058.1| gi|88194851|ref|YP_499649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]