SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88196225|ref|YP_501044.1| from Staphylococcus aureus subsp. aureus NCTC 8325

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88196225|ref|YP_501044.1|
Domain Number 1 Region: 251-775
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.96e-190
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000491
Further Details:      
 
Domain Number 2 Region: 794-937
Classification Level Classification E-value
Superfamily ADC-like 2.49e-30
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0017
Further Details:      
 
Domain Number 3 Region: 78-210
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.44e-28
Family Ferredoxin domains from multidomain proteins 0.038
Further Details:      
 
Domain Number 4 Region: 6-74
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000804
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88196225|ref|YP_501044.1|
Sequence length 984
Comment formate dehydrogenase subunit alpha [Staphylococcus aureus subsp. aureus NCTC 8325]
Sequence
MQEHLVVTLDGKDYLVEPGTNLLEFIKSQDTFVPSICYNESMGPIQTCDTCTVEIDGKIE
RSCSTVIDRPMTVNTVNNDVKDAQKEALDRILEKHMLYCTVCDYNNGDCEIHNTMDAWGL
QHQTYEYKEKPYEKDYGPFYRYDPNQCILCGRCVEACQDIEVNETIRIDWDREHPRVIWD
NDVPINESSCVSCGQCATVCPCNAMMEVNMEGNAGYMTDTEPGSLAAMIDLTKKAEPGYG
PLFAISDSEAEMRKERIKKTKTVCTYCGVGCSFEVWTKDREILKVQPSHDSPANKIATCV
KGKFSWGHINSDQRLTKPLVRKNGEFHEVEWDEALNVIADNFTAIKEKHGPDALSFISSS
KATNEESYLMQKLARQVIGTNNVDNCSRYCQAPATKGLFRTVGHGGDSGSIEDLEKAAMS
VLIGTNTAEAHPVIASRMKRAQKLFGQKIHVFDIRKHEMAERADRFYQPKPGTDLAWLSA
VTKYIIDHDLHDKAFIDEWVDDFDEYYKSLETFTMAFAEEATGIPESELIKFAEECAKAE
SVVICWAMGITQQDIGSDSSTAISNLLLVTGNYRRPGTGAYPLRGHNNVQGCSDMGSMPD
KITGYQSIEADDIRAKFEKEYGVKLNPKAGKDNHEMVEGIHDGEVHSLYLYGEDTGIVDS
NINFVQAAFEKLDFMVVQDEFLTFTATYADVVLPASPSLEKDGTFTNTERRIQRLYQALE
PLGDSKPDWKIFQAIANRLGFDWNYKHPSEIMDEVARLTPLYAGVSYDRLEGFNSLQWPV
QPDGTDEPILYLEGFNFDNGKAKLFPLSFDNYFKQDEIYDIHVNNGRLLEHFHEGNMTYQ
TPMIKYKVPRAFVEISPELAEDRGIHEGAEVKLISETGEAVLQVHVTDRVKGKEIYIPLN
NDAMENGDLGAINLLTNSDVDQYTDTPSYKRTSCRLEVITKRGKSPLNPNNFRVNKKRQP
QYSVQVQKKWERSDYVFPGNQVDK
Download sequence
Identical sequences A0A0E1AP10 A0A0H3KA29 A0A1E8WW63 A0A266CYW0 A0A2K4E6M8 Q2FEI5 Q2FVV9 Q5HDP9
gi|151222422|ref|YP_001333244.1| gi|88196225|ref|YP_501044.1| gi|479330307|ref|YP_007869366.1| gi|161510504|ref|YP_001576163.1| gi|384862951|ref|YP_005745671.1| gi|387144011|ref|YP_005732405.1| 426430.NWMN_2210 451515.SAUSA300_2258 451516.USA300HOU_2291 93061.SAOUHSC_02582 93062.SACOL2301 gi|554645202|ref|YP_008716993.1| gi|379015431|ref|YP_005291667.1| gi|384870857|ref|YP_005753571.1| gi|87161471|ref|YP_494893.1| gi|57652241|ref|YP_187108.1| WP_001155264.1.100013 WP_001155264.1.100041 WP_001155264.1.100049 WP_001155264.1.100057 WP_001155264.1.100067 WP_001155264.1.100072 WP_001155264.1.100088 WP_001155264.1.100090 WP_001155264.1.100094 WP_001155264.1.100154 WP_001155264.1.100180 WP_001155264.1.100189 WP_001155264.1.100298 WP_001155264.1.100307 WP_001155264.1.100352 WP_001155264.1.100391 WP_001155264.1.10041 WP_001155264.1.100618 WP_001155264.1.100631 WP_001155264.1.100647 WP_001155264.1.100761 WP_001155264.1.100768 WP_001155264.1.100834 WP_001155264.1.100903 WP_001155264.1.100920 WP_001155264.1.100963 WP_001155264.1.100981 WP_001155264.1.100987 WP_001155264.1.101017 WP_001155264.1.101084 WP_001155264.1.101177 WP_001155264.1.101240 WP_001155264.1.101266 WP_001155264.1.101327 WP_001155264.1.101375 WP_001155264.1.101393 WP_001155264.1.101490 WP_001155264.1.101505 WP_001155264.1.101566 WP_001155264.1.101570 WP_001155264.1.101615 WP_001155264.1.10166 WP_001155264.1.101725 WP_001155264.1.101757 WP_001155264.1.101788 WP_001155264.1.101950 WP_001155264.1.1022 WP_001155264.1.10397 WP_001155264.1.10431 WP_001155264.1.10486 WP_001155264.1.10503 WP_001155264.1.10542 WP_001155264.1.10543 WP_001155264.1.10565 WP_001155264.1.10614 WP_001155264.1.10679 WP_001155264.1.10707 WP_001155264.1.10726 WP_001155264.1.10742 WP_001155264.1.10950 WP_001155264.1.11129 WP_001155264.1.1120 WP_001155264.1.11287 WP_001155264.1.11294 WP_001155264.1.11348 WP_001155264.1.11353 WP_001155264.1.1136 WP_001155264.1.11407 WP_001155264.1.11488 WP_001155264.1.11525 WP_001155264.1.11558 WP_001155264.1.11592 WP_001155264.1.11665 WP_001155264.1.11692 WP_001155264.1.117 WP_001155264.1.11719 WP_001155264.1.11720 WP_001155264.1.11829 WP_001155264.1.11991 WP_001155264.1.12005 WP_001155264.1.1205 WP_001155264.1.12073 WP_001155264.1.12098 WP_001155264.1.12123 WP_001155264.1.12179 WP_001155264.1.12226 WP_001155264.1.12233 WP_001155264.1.12297 WP_001155264.1.12328 WP_001155264.1.12447 WP_001155264.1.12498 WP_001155264.1.12715 WP_001155264.1.12771 WP_001155264.1.12822 WP_001155264.1.12833 WP_001155264.1.12845 WP_001155264.1.12862 WP_001155264.1.12903 WP_001155264.1.12937 WP_001155264.1.12938 WP_001155264.1.13039 WP_001155264.1.13072 WP_001155264.1.13091 WP_001155264.1.13104 WP_001155264.1.13322 WP_001155264.1.13468 WP_001155264.1.1347 WP_001155264.1.13486 WP_001155264.1.1355 WP_001155264.1.13556 WP_001155264.1.13568 WP_001155264.1.13617 WP_001155264.1.13654 WP_001155264.1.13683 WP_001155264.1.13726 WP_001155264.1.13727 WP_001155264.1.1374 WP_001155264.1.13755 WP_001155264.1.13772 WP_001155264.1.13804 WP_001155264.1.13805 WP_001155264.1.13914 WP_001155264.1.13940 WP_001155264.1.13983 WP_001155264.1.14071 WP_001155264.1.14112 WP_001155264.1.14153 WP_001155264.1.14233 WP_001155264.1.1426 WP_001155264.1.14365 WP_001155264.1.14394 WP_001155264.1.14418 WP_001155264.1.14475 WP_001155264.1.147 WP_001155264.1.14744 WP_001155264.1.1477 WP_001155264.1.14790 WP_001155264.1.14809 WP_001155264.1.14869 WP_001155264.1.14888 WP_001155264.1.14902 WP_001155264.1.14987 WP_001155264.1.15000 WP_001155264.1.15091 WP_001155264.1.15228 WP_001155264.1.15255 WP_001155264.1.15263 WP_001155264.1.15278 WP_001155264.1.15329 WP_001155264.1.15399 WP_001155264.1.15409 WP_001155264.1.15438 WP_001155264.1.1545 WP_001155264.1.15489 WP_001155264.1.15505 WP_001155264.1.15524 WP_001155264.1.15572 WP_001155264.1.15687 WP_001155264.1.15706 WP_001155264.1.1579 WP_001155264.1.15818 WP_001155264.1.1583 WP_001155264.1.15838 WP_001155264.1.15883 WP_001155264.1.15892 WP_001155264.1.15897 WP_001155264.1.15898 WP_001155264.1.15928 WP_001155264.1.15957 WP_001155264.1.15972 WP_001155264.1.1600 WP_001155264.1.1606 WP_001155264.1.16112 WP_001155264.1.16213 WP_001155264.1.16237 WP_001155264.1.16362 WP_001155264.1.16417 WP_001155264.1.16554 WP_001155264.1.16603 WP_001155264.1.16617 WP_001155264.1.16628 WP_001155264.1.16672 WP_001155264.1.16679 WP_001155264.1.16688 WP_001155264.1.16757 WP_001155264.1.16768 WP_001155264.1.16770 WP_001155264.1.16776 WP_001155264.1.16892 WP_001155264.1.16946 WP_001155264.1.17038 WP_001155264.1.17104 WP_001155264.1.17137 WP_001155264.1.17169 WP_001155264.1.17210 WP_001155264.1.17234 WP_001155264.1.17249 WP_001155264.1.17256 WP_001155264.1.17320 WP_001155264.1.17450 WP_001155264.1.17485 WP_001155264.1.17520 WP_001155264.1.17581 WP_001155264.1.17657 WP_001155264.1.17666 WP_001155264.1.17676 WP_001155264.1.17770 WP_001155264.1.17834 WP_001155264.1.17859 WP_001155264.1.17876 WP_001155264.1.17929 WP_001155264.1.17951 WP_001155264.1.18016 WP_001155264.1.18035 WP_001155264.1.18074 WP_001155264.1.18105 WP_001155264.1.18197 WP_001155264.1.18283 WP_001155264.1.18320 WP_001155264.1.1835 WP_001155264.1.18437 WP_001155264.1.18451 WP_001155264.1.1851 WP_001155264.1.18516 WP_001155264.1.18529 WP_001155264.1.18538 WP_001155264.1.18562 WP_001155264.1.18611 WP_001155264.1.18627 WP_001155264.1.18658 WP_001155264.1.18668 WP_001155264.1.18758 WP_001155264.1.18809 WP_001155264.1.18830 WP_001155264.1.18836 WP_001155264.1.18879 WP_001155264.1.18918 WP_001155264.1.18938 WP_001155264.1.18987 WP_001155264.1.19009 WP_001155264.1.1901 WP_001155264.1.19149 WP_001155264.1.19179 WP_001155264.1.192 WP_001155264.1.19272 WP_001155264.1.19390 WP_001155264.1.19411 WP_001155264.1.19444 WP_001155264.1.19509 WP_001155264.1.19733 WP_001155264.1.19765 WP_001155264.1.19775 WP_001155264.1.19807 WP_001155264.1.19853 WP_001155264.1.20057 WP_001155264.1.20101 WP_001155264.1.2013 WP_001155264.1.20155 WP_001155264.1.20160 WP_001155264.1.20210 WP_001155264.1.20235 WP_001155264.1.20354 WP_001155264.1.20386 WP_001155264.1.20473 WP_001155264.1.20554 WP_001155264.1.20772 WP_001155264.1.20833 WP_001155264.1.20860 WP_001155264.1.20975 WP_001155264.1.21013 WP_001155264.1.21054 WP_001155264.1.21080 WP_001155264.1.21081 WP_001155264.1.2128 WP_001155264.1.21312 WP_001155264.1.21356 WP_001155264.1.21386 WP_001155264.1.21402 WP_001155264.1.21465 WP_001155264.1.2154 WP_001155264.1.21583 WP_001155264.1.21601 WP_001155264.1.21679 WP_001155264.1.21712 WP_001155264.1.21820 WP_001155264.1.21890 WP_001155264.1.21901 WP_001155264.1.22045 WP_001155264.1.22163 WP_001155264.1.22165 WP_001155264.1.22170 WP_001155264.1.22174 WP_001155264.1.22246 WP_001155264.1.22344 WP_001155264.1.22351 WP_001155264.1.22367 WP_001155264.1.22526 WP_001155264.1.22551 WP_001155264.1.22657 WP_001155264.1.22731 WP_001155264.1.2280 WP_001155264.1.22811 WP_001155264.1.22843 WP_001155264.1.22994 WP_001155264.1.23004 WP_001155264.1.23152 WP_001155264.1.23228 WP_001155264.1.23238 WP_001155264.1.23381 WP_001155264.1.23420 WP_001155264.1.23450 WP_001155264.1.23489 WP_001155264.1.23491 WP_001155264.1.23541 WP_001155264.1.23544 WP_001155264.1.23586 WP_001155264.1.23613 WP_001155264.1.2365 WP_001155264.1.23822 WP_001155264.1.23849 WP_001155264.1.23935 WP_001155264.1.23998 WP_001155264.1.24148 WP_001155264.1.24167 WP_001155264.1.2423 WP_001155264.1.24241 WP_001155264.1.24279 WP_001155264.1.24364 WP_001155264.1.24418 WP_001155264.1.24443 WP_001155264.1.24478 WP_001155264.1.2458 WP_001155264.1.24617 WP_001155264.1.24745 WP_001155264.1.24781 WP_001155264.1.2480 WP_001155264.1.24802 WP_001155264.1.24891 WP_001155264.1.25083 WP_001155264.1.25170 WP_001155264.1.25469 WP_001155264.1.25479 WP_001155264.1.25511 WP_001155264.1.25567 WP_001155264.1.25593 WP_001155264.1.25737 WP_001155264.1.25770 WP_001155264.1.2579 WP_001155264.1.25820 WP_001155264.1.25867 WP_001155264.1.25868 WP_001155264.1.25881 WP_001155264.1.25891 WP_001155264.1.25924 WP_001155264.1.2593 WP_001155264.1.26006 WP_001155264.1.26015 WP_001155264.1.262 WP_001155264.1.26293 WP_001155264.1.26307 WP_001155264.1.26370 WP_001155264.1.26405 WP_001155264.1.26481 WP_001155264.1.2658 WP_001155264.1.2661 WP_001155264.1.26626 WP_001155264.1.2664 WP_001155264.1.26663 WP_001155264.1.26733 WP_001155264.1.26771 WP_001155264.1.26790 WP_001155264.1.26927 WP_001155264.1.26958 WP_001155264.1.27042 WP_001155264.1.27154 WP_001155264.1.27246 WP_001155264.1.27311 WP_001155264.1.27333 WP_001155264.1.2734 WP_001155264.1.27345 WP_001155264.1.27455 WP_001155264.1.27551 WP_001155264.1.27562 WP_001155264.1.2759 WP_001155264.1.27608 WP_001155264.1.27614 WP_001155264.1.27615 WP_001155264.1.27654 WP_001155264.1.27670 WP_001155264.1.2768 WP_001155264.1.27748 WP_001155264.1.27817 WP_001155264.1.27854 WP_001155264.1.27950 WP_001155264.1.27953 WP_001155264.1.27972 WP_001155264.1.28007 WP_001155264.1.28063 WP_001155264.1.28071 WP_001155264.1.28088 WP_001155264.1.28117 WP_001155264.1.28147 WP_001155264.1.28158 WP_001155264.1.28191 WP_001155264.1.28207 WP_001155264.1.28358 WP_001155264.1.28360 WP_001155264.1.28376 WP_001155264.1.28381 WP_001155264.1.28477 WP_001155264.1.28498 WP_001155264.1.28502 WP_001155264.1.28527 WP_001155264.1.28532 WP_001155264.1.28650 WP_001155264.1.28675 WP_001155264.1.28710 WP_001155264.1.28725 WP_001155264.1.28862 WP_001155264.1.28887 WP_001155264.1.28933 WP_001155264.1.28960 WP_001155264.1.28970 WP_001155264.1.29107 WP_001155264.1.29188 WP_001155264.1.29207 WP_001155264.1.29272 WP_001155264.1.29282 WP_001155264.1.29312 WP_001155264.1.29372 WP_001155264.1.29373 WP_001155264.1.29381 WP_001155264.1.29511 WP_001155264.1.29561 WP_001155264.1.29596 WP_001155264.1.29644 WP_001155264.1.29676 WP_001155264.1.2975 WP_001155264.1.29758 WP_001155264.1.29781 WP_001155264.1.29805 WP_001155264.1.29885 WP_001155264.1.29963 WP_001155264.1.30012 WP_001155264.1.30023 WP_001155264.1.30033 WP_001155264.1.30047 WP_001155264.1.30057 WP_001155264.1.30154 WP_001155264.1.30176 WP_001155264.1.30333 WP_001155264.1.30367 WP_001155264.1.30376 WP_001155264.1.30381 WP_001155264.1.30418 WP_001155264.1.30422 WP_001155264.1.30477 WP_001155264.1.30530 WP_001155264.1.30623 WP_001155264.1.30758 WP_001155264.1.30779 WP_001155264.1.30862 WP_001155264.1.30863 WP_001155264.1.30874 WP_001155264.1.30878 WP_001155264.1.30889 WP_001155264.1.30916 WP_001155264.1.3097 WP_001155264.1.30970 WP_001155264.1.30971 WP_001155264.1.30998 WP_001155264.1.31037 WP_001155264.1.31068 WP_001155264.1.31124 WP_001155264.1.31194 WP_001155264.1.31232 WP_001155264.1.31376 WP_001155264.1.31462 WP_001155264.1.31478 WP_001155264.1.315 WP_001155264.1.31567 WP_001155264.1.31611 WP_001155264.1.31638 WP_001155264.1.31667 WP_001155264.1.31787 WP_001155264.1.31797 WP_001155264.1.31817 WP_001155264.1.31897 WP_001155264.1.31925 WP_001155264.1.31949 WP_001155264.1.31994 WP_001155264.1.32118 WP_001155264.1.32122 WP_001155264.1.32167 WP_001155264.1.32217 WP_001155264.1.32244 WP_001155264.1.32248 WP_001155264.1.32281 WP_001155264.1.32295 WP_001155264.1.32365 WP_001155264.1.32405 WP_001155264.1.3244 WP_001155264.1.32454 WP_001155264.1.32464 WP_001155264.1.32739 WP_001155264.1.32839 WP_001155264.1.32921 WP_001155264.1.32987 WP_001155264.1.3299 WP_001155264.1.3306 WP_001155264.1.33108 WP_001155264.1.33147 WP_001155264.1.33213 WP_001155264.1.33252 WP_001155264.1.33255 WP_001155264.1.33307 WP_001155264.1.3335 WP_001155264.1.33350 WP_001155264.1.33372 WP_001155264.1.3338 WP_001155264.1.33388 WP_001155264.1.3345 WP_001155264.1.33463 WP_001155264.1.33483 WP_001155264.1.33484 WP_001155264.1.33520 WP_001155264.1.33575 WP_001155264.1.33650 WP_001155264.1.33724 WP_001155264.1.33737 WP_001155264.1.33756 WP_001155264.1.33766 WP_001155264.1.33778 WP_001155264.1.33899 WP_001155264.1.33949 WP_001155264.1.33994 WP_001155264.1.34069 WP_001155264.1.34105 WP_001155264.1.34112 WP_001155264.1.3418 WP_001155264.1.34194 WP_001155264.1.34361 WP_001155264.1.3442 WP_001155264.1.34471 WP_001155264.1.34512 WP_001155264.1.34569 WP_001155264.1.34716 WP_001155264.1.34723 WP_001155264.1.3474 WP_001155264.1.34741 WP_001155264.1.34865 WP_001155264.1.34923 WP_001155264.1.34926 WP_001155264.1.34967 WP_001155264.1.35031 WP_001155264.1.35289 WP_001155264.1.35314 WP_001155264.1.35340 WP_001155264.1.35391 WP_001155264.1.35413 WP_001155264.1.35508 WP_001155264.1.35517 WP_001155264.1.35519 WP_001155264.1.35549 WP_001155264.1.35642 WP_001155264.1.35661 WP_001155264.1.35686 WP_001155264.1.35696 WP_001155264.1.35784 WP_001155264.1.3579 WP_001155264.1.35890 WP_001155264.1.35903 WP_001155264.1.36179 WP_001155264.1.36208 WP_001155264.1.36249 WP_001155264.1.36302 WP_001155264.1.36430 WP_001155264.1.36434 WP_001155264.1.36439 WP_001155264.1.36640 WP_001155264.1.36704 WP_001155264.1.36729 WP_001155264.1.36773 WP_001155264.1.36814 WP_001155264.1.36847 WP_001155264.1.36888 WP_001155264.1.36903 WP_001155264.1.36911 WP_001155264.1.3709 WP_001155264.1.37120 WP_001155264.1.37130 WP_001155264.1.37145 WP_001155264.1.37159 WP_001155264.1.3722 WP_001155264.1.37240 WP_001155264.1.37335 WP_001155264.1.37411 WP_001155264.1.37435 WP_001155264.1.37644 WP_001155264.1.37669 WP_001155264.1.37679 WP_001155264.1.3774 WP_001155264.1.37749 WP_001155264.1.37764 WP_001155264.1.37771 WP_001155264.1.37788 WP_001155264.1.37906 WP_001155264.1.37907 WP_001155264.1.37929 WP_001155264.1.38030 WP_001155264.1.38111 WP_001155264.1.38128 WP_001155264.1.38136 WP_001155264.1.38222 WP_001155264.1.38304 WP_001155264.1.38516 WP_001155264.1.38555 WP_001155264.1.3875 WP_001155264.1.38875 WP_001155264.1.38885 WP_001155264.1.38890 WP_001155264.1.38927 WP_001155264.1.39017 WP_001155264.1.39026 WP_001155264.1.39126 WP_001155264.1.39166 WP_001155264.1.39330 WP_001155264.1.39361 WP_001155264.1.39432 WP_001155264.1.39499 WP_001155264.1.39542 WP_001155264.1.39642 WP_001155264.1.39670 WP_001155264.1.39671 WP_001155264.1.39682 WP_001155264.1.39693 WP_001155264.1.39857 WP_001155264.1.39943 WP_001155264.1.39995 WP_001155264.1.40076 WP_001155264.1.4010 WP_001155264.1.40149 WP_001155264.1.40247 WP_001155264.1.40329 WP_001155264.1.40369 WP_001155264.1.40428 WP_001155264.1.40483 WP_001155264.1.40500 WP_001155264.1.40613 WP_001155264.1.40670 WP_001155264.1.40700 WP_001155264.1.40729 WP_001155264.1.40780 WP_001155264.1.40814 WP_001155264.1.40939 WP_001155264.1.40997 WP_001155264.1.41033 WP_001155264.1.41038 WP_001155264.1.4105 WP_001155264.1.41350 WP_001155264.1.41386 WP_001155264.1.41389 WP_001155264.1.41555 WP_001155264.1.41581 WP_001155264.1.41587 WP_001155264.1.41598 WP_001155264.1.41612 WP_001155264.1.41620 WP_001155264.1.41681 WP_001155264.1.4169 WP_001155264.1.41743 WP_001155264.1.41755 WP_001155264.1.41796 WP_001155264.1.4182 WP_001155264.1.41863 WP_001155264.1.41972 WP_001155264.1.42003 WP_001155264.1.4202 WP_001155264.1.42056 WP_001155264.1.42072 WP_001155264.1.42085 WP_001155264.1.42169 WP_001155264.1.42178 WP_001155264.1.42241 WP_001155264.1.4225 WP_001155264.1.42298 WP_001155264.1.42325 WP_001155264.1.42344 WP_001155264.1.42607 WP_001155264.1.42681 WP_001155264.1.42733 WP_001155264.1.42764 WP_001155264.1.42798 WP_001155264.1.42816 WP_001155264.1.42907 WP_001155264.1.42925 WP_001155264.1.42959 WP_001155264.1.42984 WP_001155264.1.42990 WP_001155264.1.43023 WP_001155264.1.43061 WP_001155264.1.43095 WP_001155264.1.43110 WP_001155264.1.43125 WP_001155264.1.43139 WP_001155264.1.43168 WP_001155264.1.43179 WP_001155264.1.43204 WP_001155264.1.43252 WP_001155264.1.43279 WP_001155264.1.43360 WP_001155264.1.43375 WP_001155264.1.43405 WP_001155264.1.43446 WP_001155264.1.43512 WP_001155264.1.43665 WP_001155264.1.43784 WP_001155264.1.4386 WP_001155264.1.43995 WP_001155264.1.44074 WP_001155264.1.44177 WP_001155264.1.44178 WP_001155264.1.44344 WP_001155264.1.44382 WP_001155264.1.44432 WP_001155264.1.44504 WP_001155264.1.44515 WP_001155264.1.44520 WP_001155264.1.44586 WP_001155264.1.44623 WP_001155264.1.44667 WP_001155264.1.447 WP_001155264.1.44715 WP_001155264.1.44868 WP_001155264.1.44876 WP_001155264.1.44892 WP_001155264.1.44993 WP_001155264.1.45042 WP_001155264.1.45091 WP_001155264.1.45094 WP_001155264.1.45140 WP_001155264.1.45157 WP_001155264.1.45162 WP_001155264.1.45242 WP_001155264.1.45267 WP_001155264.1.4527 WP_001155264.1.45281 WP_001155264.1.45450 WP_001155264.1.45456 WP_001155264.1.4546 WP_001155264.1.45542 WP_001155264.1.45555 WP_001155264.1.45574 WP_001155264.1.45610 WP_001155264.1.45645 WP_001155264.1.45705 WP_001155264.1.45763 WP_001155264.1.4577 WP_001155264.1.45773 WP_001155264.1.4582 WP_001155264.1.45859 WP_001155264.1.45862 WP_001155264.1.45874 WP_001155264.1.4597 WP_001155264.1.45972 WP_001155264.1.45977 WP_001155264.1.45979 WP_001155264.1.46037 WP_001155264.1.46050 WP_001155264.1.46062 WP_001155264.1.46171 WP_001155264.1.46172 WP_001155264.1.46185 WP_001155264.1.46248 WP_001155264.1.46333 WP_001155264.1.46339 WP_001155264.1.46353 WP_001155264.1.46529 WP_001155264.1.46619 WP_001155264.1.46648 WP_001155264.1.46720 WP_001155264.1.46736 WP_001155264.1.46770 WP_001155264.1.4680 WP_001155264.1.46906 WP_001155264.1.46914 WP_001155264.1.46929 WP_001155264.1.4694 WP_001155264.1.46947 WP_001155264.1.47002 WP_001155264.1.47107 WP_001155264.1.47111 WP_001155264.1.47282 WP_001155264.1.47334 WP_001155264.1.47408 WP_001155264.1.47459 WP_001155264.1.47522 WP_001155264.1.47617 WP_001155264.1.47669 WP_001155264.1.47680 WP_001155264.1.47747 WP_001155264.1.47851 WP_001155264.1.47908 WP_001155264.1.4792 WP_001155264.1.48046 WP_001155264.1.48064 WP_001155264.1.48067 WP_001155264.1.48116 WP_001155264.1.48142 WP_001155264.1.48156 WP_001155264.1.48187 WP_001155264.1.48223 WP_001155264.1.48272 WP_001155264.1.48282 WP_001155264.1.48310 WP_001155264.1.48338 WP_001155264.1.48376 WP_001155264.1.48398 WP_001155264.1.4840 WP_001155264.1.48427 WP_001155264.1.48437 WP_001155264.1.48438 WP_001155264.1.48479 WP_001155264.1.4852 WP_001155264.1.48580 WP_001155264.1.48664 WP_001155264.1.48670 WP_001155264.1.48723 WP_001155264.1.48769 WP_001155264.1.49018 WP_001155264.1.49071 WP_001155264.1.49094 WP_001155264.1.49105 WP_001155264.1.49171 WP_001155264.1.49189 WP_001155264.1.49196 WP_001155264.1.49199 WP_001155264.1.4924 WP_001155264.1.49257 WP_001155264.1.49301 WP_001155264.1.49326 WP_001155264.1.49362 WP_001155264.1.4945 WP_001155264.1.49518 WP_001155264.1.49549 WP_001155264.1.49581 WP_001155264.1.49582 WP_001155264.1.496 WP_001155264.1.49603 WP_001155264.1.49643 WP_001155264.1.49672 WP_001155264.1.49690 WP_001155264.1.49728 WP_001155264.1.49732 WP_001155264.1.49745 WP_001155264.1.49819 WP_001155264.1.49918 WP_001155264.1.49935 WP_001155264.1.50028 WP_001155264.1.50117 WP_001155264.1.50145 WP_001155264.1.50178 WP_001155264.1.50192 WP_001155264.1.50291 WP_001155264.1.50367 WP_001155264.1.50388 WP_001155264.1.5045 WP_001155264.1.50464 WP_001155264.1.50525 WP_001155264.1.50558 WP_001155264.1.50568 WP_001155264.1.5059 WP_001155264.1.50594 WP_001155264.1.50647 WP_001155264.1.50699 WP_001155264.1.50740 WP_001155264.1.50829 WP_001155264.1.50974 WP_001155264.1.51130 WP_001155264.1.51209 WP_001155264.1.51226 WP_001155264.1.51271 WP_001155264.1.51277 WP_001155264.1.51326 WP_001155264.1.51393 WP_001155264.1.51496 WP_001155264.1.51557 WP_001155264.1.51741 WP_001155264.1.51794 WP_001155264.1.51824 WP_001155264.1.52034 WP_001155264.1.52061 WP_001155264.1.52072 WP_001155264.1.52195 WP_001155264.1.52198 WP_001155264.1.52210 WP_001155264.1.52289 WP_001155264.1.52308 WP_001155264.1.52343 WP_001155264.1.52377 WP_001155264.1.52396 WP_001155264.1.52427 WP_001155264.1.52452 WP_001155264.1.5251 WP_001155264.1.52511 WP_001155264.1.52605 WP_001155264.1.52830 WP_001155264.1.52889 WP_001155264.1.52900 WP_001155264.1.52965 WP_001155264.1.52983 WP_001155264.1.5304 WP_001155264.1.53050 WP_001155264.1.5319 WP_001155264.1.53245 WP_001155264.1.53312 WP_001155264.1.53363 WP_001155264.1.53373 WP_001155264.1.53379 WP_001155264.1.53408 WP_001155264.1.53452 WP_001155264.1.53467 WP_001155264.1.5347 WP_001155264.1.53774 WP_001155264.1.53799 WP_001155264.1.53911 WP_001155264.1.53926 WP_001155264.1.54049 WP_001155264.1.54074 WP_001155264.1.54086 WP_001155264.1.54237 WP_001155264.1.54290 WP_001155264.1.54299 WP_001155264.1.54404 WP_001155264.1.54438 WP_001155264.1.54471 WP_001155264.1.54485 WP_001155264.1.54554 WP_001155264.1.54574 WP_001155264.1.54744 WP_001155264.1.54830 WP_001155264.1.54851 WP_001155264.1.54929 WP_001155264.1.54931 WP_001155264.1.54967 WP_001155264.1.54990 WP_001155264.1.5500 WP_001155264.1.55004 WP_001155264.1.55082 WP_001155264.1.55084 WP_001155264.1.55095 WP_001155264.1.55139 WP_001155264.1.5518 WP_001155264.1.552 WP_001155264.1.55239 WP_001155264.1.55271 WP_001155264.1.55327 WP_001155264.1.55336 WP_001155264.1.55419 WP_001155264.1.55495 WP_001155264.1.5550 WP_001155264.1.55527 WP_001155264.1.55535 WP_001155264.1.55603 WP_001155264.1.55719 WP_001155264.1.55724 WP_001155264.1.55845 WP_001155264.1.55955 WP_001155264.1.56003 WP_001155264.1.5604 WP_001155264.1.56064 WP_001155264.1.56106 WP_001155264.1.56135 WP_001155264.1.56159 WP_001155264.1.56237 WP_001155264.1.56265 WP_001155264.1.56387 WP_001155264.1.56464 WP_001155264.1.56482 WP_001155264.1.56542 WP_001155264.1.56608 WP_001155264.1.56619 WP_001155264.1.56702 WP_001155264.1.56708 WP_001155264.1.56737 WP_001155264.1.5675 WP_001155264.1.56779 WP_001155264.1.56822 WP_001155264.1.56903 WP_001155264.1.56931 WP_001155264.1.56966 WP_001155264.1.56975 WP_001155264.1.57015 WP_001155264.1.5705 WP_001155264.1.57081 WP_001155264.1.57115 WP_001155264.1.57141 WP_001155264.1.57330 WP_001155264.1.57427 WP_001155264.1.57448 WP_001155264.1.57593 WP_001155264.1.57670 WP_001155264.1.57693 WP_001155264.1.57701 WP_001155264.1.57718 WP_001155264.1.57727 WP_001155264.1.57745 WP_001155264.1.57783 WP_001155264.1.57844 WP_001155264.1.57962 WP_001155264.1.5799 WP_001155264.1.58006 WP_001155264.1.58051 WP_001155264.1.58122 WP_001155264.1.5817 WP_001155264.1.58198 WP_001155264.1.58241 WP_001155264.1.58246 WP_001155264.1.58325 WP_001155264.1.58350 WP_001155264.1.58353 WP_001155264.1.58366 WP_001155264.1.58373 WP_001155264.1.58392 WP_001155264.1.58421 WP_001155264.1.58481 WP_001155264.1.5849 WP_001155264.1.58508 WP_001155264.1.58521 WP_001155264.1.586 WP_001155264.1.58603 WP_001155264.1.58714 WP_001155264.1.58775 WP_001155264.1.58998 WP_001155264.1.5901 WP_001155264.1.5904 WP_001155264.1.59133 WP_001155264.1.5925 WP_001155264.1.59269 WP_001155264.1.59284 WP_001155264.1.59327 WP_001155264.1.59363 WP_001155264.1.59397 WP_001155264.1.59457 WP_001155264.1.59459 WP_001155264.1.59467 WP_001155264.1.59478 WP_001155264.1.59603 WP_001155264.1.59609 WP_001155264.1.59629 WP_001155264.1.59663 WP_001155264.1.59697 WP_001155264.1.59803 WP_001155264.1.59881 WP_001155264.1.59977 WP_001155264.1.60022 WP_001155264.1.60086 WP_001155264.1.60156 WP_001155264.1.60181 WP_001155264.1.60251 WP_001155264.1.60259 WP_001155264.1.60280 WP_001155264.1.60307 WP_001155264.1.60368 WP_001155264.1.60462 WP_001155264.1.60515 WP_001155264.1.60551 WP_001155264.1.60594 WP_001155264.1.60690 WP_001155264.1.60696 WP_001155264.1.60787 WP_001155264.1.60898 WP_001155264.1.60939 WP_001155264.1.60981 WP_001155264.1.61030 WP_001155264.1.61119 WP_001155264.1.61152 WP_001155264.1.61153 WP_001155264.1.6118 WP_001155264.1.61188 WP_001155264.1.61257 WP_001155264.1.61324 WP_001155264.1.61339 WP_001155264.1.61408 WP_001155264.1.61413 WP_001155264.1.61421 WP_001155264.1.61547 WP_001155264.1.61591 WP_001155264.1.6168 WP_001155264.1.61784 WP_001155264.1.61910 WP_001155264.1.61970 WP_001155264.1.62030 WP_001155264.1.62088 WP_001155264.1.62093 WP_001155264.1.62140 WP_001155264.1.62164 WP_001155264.1.62367 WP_001155264.1.62409 WP_001155264.1.62459 WP_001155264.1.62537 WP_001155264.1.62539 WP_001155264.1.62575 WP_001155264.1.62685 WP_001155264.1.62740 WP_001155264.1.62756 WP_001155264.1.62781 WP_001155264.1.62796 WP_001155264.1.62808 WP_001155264.1.62829 WP_001155264.1.62842 WP_001155264.1.62878 WP_001155264.1.62956 WP_001155264.1.63011 WP_001155264.1.63050 WP_001155264.1.631 WP_001155264.1.63132 WP_001155264.1.63182 WP_001155264.1.63195 WP_001155264.1.63244 WP_001155264.1.63273 WP_001155264.1.63279 WP_001155264.1.63296 WP_001155264.1.63307 WP_001155264.1.63319 WP_001155264.1.63324 WP_001155264.1.63335 WP_001155264.1.63337 WP_001155264.1.63383 WP_001155264.1.63406 WP_001155264.1.63411 WP_001155264.1.63421 WP_001155264.1.63460 WP_001155264.1.63510 WP_001155264.1.63527 WP_001155264.1.63565 WP_001155264.1.63617 WP_001155264.1.63693 WP_001155264.1.63705 WP_001155264.1.6378 WP_001155264.1.63847 WP_001155264.1.63894 WP_001155264.1.64012 WP_001155264.1.64094 WP_001155264.1.64108 WP_001155264.1.64207 WP_001155264.1.64303 WP_001155264.1.64368 WP_001155264.1.64628 WP_001155264.1.64643 WP_001155264.1.64665 WP_001155264.1.64811 WP_001155264.1.64845 WP_001155264.1.64860 WP_001155264.1.64951 WP_001155264.1.64956 WP_001155264.1.64996 WP_001155264.1.64998 WP_001155264.1.65025 WP_001155264.1.65038 WP_001155264.1.65076 WP_001155264.1.65233 WP_001155264.1.65264 WP_001155264.1.65387 WP_001155264.1.65406 WP_001155264.1.65407 WP_001155264.1.6544 WP_001155264.1.65448 WP_001155264.1.65585 WP_001155264.1.65616 WP_001155264.1.65629 WP_001155264.1.65643 WP_001155264.1.65656 WP_001155264.1.6568 WP_001155264.1.65713 WP_001155264.1.65734 WP_001155264.1.65769 WP_001155264.1.65809 WP_001155264.1.6585 WP_001155264.1.65892 WP_001155264.1.65935 WP_001155264.1.65947 WP_001155264.1.6603 WP_001155264.1.66054 WP_001155264.1.66069 WP_001155264.1.66073 WP_001155264.1.66130 WP_001155264.1.66144 WP_001155264.1.66265 WP_001155264.1.66298 WP_001155264.1.6632 WP_001155264.1.66366 WP_001155264.1.66453 WP_001155264.1.66513 WP_001155264.1.66556 WP_001155264.1.66598 WP_001155264.1.66611 WP_001155264.1.66614 WP_001155264.1.66705 WP_001155264.1.66766 WP_001155264.1.66803 WP_001155264.1.66816 WP_001155264.1.6688 WP_001155264.1.66938 WP_001155264.1.66969 WP_001155264.1.67012 WP_001155264.1.67014 WP_001155264.1.67067 WP_001155264.1.67072 WP_001155264.1.67113 WP_001155264.1.67155 WP_001155264.1.67160 WP_001155264.1.67238 WP_001155264.1.67251 WP_001155264.1.67259 WP_001155264.1.6726 WP_001155264.1.67286 WP_001155264.1.67294 WP_001155264.1.67312 WP_001155264.1.67328 WP_001155264.1.67418 WP_001155264.1.67420 WP_001155264.1.67425 WP_001155264.1.67457 WP_001155264.1.67460 WP_001155264.1.67571 WP_001155264.1.67621 WP_001155264.1.67644 WP_001155264.1.67653 WP_001155264.1.67691 WP_001155264.1.67806 WP_001155264.1.67834 WP_001155264.1.67867 WP_001155264.1.67880 WP_001155264.1.67900 WP_001155264.1.67991 WP_001155264.1.68101 WP_001155264.1.68134 WP_001155264.1.68141 WP_001155264.1.68152 WP_001155264.1.68202 WP_001155264.1.68221 WP_001155264.1.68223 WP_001155264.1.6824 WP_001155264.1.68268 WP_001155264.1.68355 WP_001155264.1.68366 WP_001155264.1.68398 WP_001155264.1.68399 WP_001155264.1.68476 WP_001155264.1.68479 WP_001155264.1.68504 WP_001155264.1.68512 WP_001155264.1.68548 WP_001155264.1.686 WP_001155264.1.68681 WP_001155264.1.68683 WP_001155264.1.68741 WP_001155264.1.68743 WP_001155264.1.68883 WP_001155264.1.68998 WP_001155264.1.69012 WP_001155264.1.69071 WP_001155264.1.69078 WP_001155264.1.69105 WP_001155264.1.6915 WP_001155264.1.69198 WP_001155264.1.69213 WP_001155264.1.69349 WP_001155264.1.69394 WP_001155264.1.69437 WP_001155264.1.69475 WP_001155264.1.69546 WP_001155264.1.69598 WP_001155264.1.6968 WP_001155264.1.69683 WP_001155264.1.69724 WP_001155264.1.69734 WP_001155264.1.6980 WP_001155264.1.69820 WP_001155264.1.69823 WP_001155264.1.69830 WP_001155264.1.69882 WP_001155264.1.699 WP_001155264.1.69902 WP_001155264.1.69934 WP_001155264.1.69980 WP_001155264.1.69995 WP_001155264.1.70059 WP_001155264.1.70161 WP_001155264.1.70220 WP_001155264.1.70225 WP_001155264.1.70228 WP_001155264.1.70294 WP_001155264.1.70311 WP_001155264.1.70313 WP_001155264.1.70334 WP_001155264.1.70448 WP_001155264.1.7046 WP_001155264.1.70487 WP_001155264.1.70495 WP_001155264.1.70527 WP_001155264.1.70554 WP_001155264.1.70564 WP_001155264.1.7064 WP_001155264.1.70664 WP_001155264.1.707 WP_001155264.1.70721 WP_001155264.1.70763 WP_001155264.1.70808 WP_001155264.1.70835 WP_001155264.1.70843 WP_001155264.1.70909 WP_001155264.1.70926 WP_001155264.1.710 WP_001155264.1.71016 WP_001155264.1.7105 WP_001155264.1.71208 WP_001155264.1.71231 WP_001155264.1.71267 WP_001155264.1.71313 WP_001155264.1.71410 WP_001155264.1.71467 WP_001155264.1.71475 WP_001155264.1.71715 WP_001155264.1.71737 WP_001155264.1.71739 WP_001155264.1.71741 WP_001155264.1.71863 WP_001155264.1.71877 WP_001155264.1.71892 WP_001155264.1.71899 WP_001155264.1.71910 WP_001155264.1.71978 WP_001155264.1.72002 WP_001155264.1.72148 WP_001155264.1.722 WP_001155264.1.72204 WP_001155264.1.72306 WP_001155264.1.72363 WP_001155264.1.72371 WP_001155264.1.72453 WP_001155264.1.72465 WP_001155264.1.72497 WP_001155264.1.7254 WP_001155264.1.7258 WP_001155264.1.7260 WP_001155264.1.72649 WP_001155264.1.72666 WP_001155264.1.72708 WP_001155264.1.72719 WP_001155264.1.72753 WP_001155264.1.72762 WP_001155264.1.72881 WP_001155264.1.72930 WP_001155264.1.72961 WP_001155264.1.72991 WP_001155264.1.73002 WP_001155264.1.73021 WP_001155264.1.73087 WP_001155264.1.73140 WP_001155264.1.73190 WP_001155264.1.73195 WP_001155264.1.73201 WP_001155264.1.73211 WP_001155264.1.73240 WP_001155264.1.73241 WP_001155264.1.73264 WP_001155264.1.73401 WP_001155264.1.73420 WP_001155264.1.73450 WP_001155264.1.73464 WP_001155264.1.73513 WP_001155264.1.73539 WP_001155264.1.7360 WP_001155264.1.73610 WP_001155264.1.7365 WP_001155264.1.73674 WP_001155264.1.73694 WP_001155264.1.73740 WP_001155264.1.73789 WP_001155264.1.73885 WP_001155264.1.73900 WP_001155264.1.73921 WP_001155264.1.73940 WP_001155264.1.73949 WP_001155264.1.73971 WP_001155264.1.74004 WP_001155264.1.7401 WP_001155264.1.7406 WP_001155264.1.74073 WP_001155264.1.74085 WP_001155264.1.74257 WP_001155264.1.74284 WP_001155264.1.74295 WP_001155264.1.74327 WP_001155264.1.74456 WP_001155264.1.74576 WP_001155264.1.74676 WP_001155264.1.74681 WP_001155264.1.74758 WP_001155264.1.74770 WP_001155264.1.74785 WP_001155264.1.74797 WP_001155264.1.7482 WP_001155264.1.74874 WP_001155264.1.75070 WP_001155264.1.75111 WP_001155264.1.75131 WP_001155264.1.75132 WP_001155264.1.75323 WP_001155264.1.75351 WP_001155264.1.75356 WP_001155264.1.75409 WP_001155264.1.75538 WP_001155264.1.75566 WP_001155264.1.75571 WP_001155264.1.75647 WP_001155264.1.75692 WP_001155264.1.75728 WP_001155264.1.75743 WP_001155264.1.75800 WP_001155264.1.75840 WP_001155264.1.75862 WP_001155264.1.75910 WP_001155264.1.76013 WP_001155264.1.7602 WP_001155264.1.76047 WP_001155264.1.76049 WP_001155264.1.76050 WP_001155264.1.76053 WP_001155264.1.76111 WP_001155264.1.76114 WP_001155264.1.76121 WP_001155264.1.76153 WP_001155264.1.76179 WP_001155264.1.7627 WP_001155264.1.76313 WP_001155264.1.76424 WP_001155264.1.76426 WP_001155264.1.76431 WP_001155264.1.76463 WP_001155264.1.76497 WP_001155264.1.76674 WP_001155264.1.76711 WP_001155264.1.76718 WP_001155264.1.76798 WP_001155264.1.76829 WP_001155264.1.7694 WP_001155264.1.77043 WP_001155264.1.77072 WP_001155264.1.77137 WP_001155264.1.77158 WP_001155264.1.77187 WP_001155264.1.77190 WP_001155264.1.77203 WP_001155264.1.77229 WP_001155264.1.77297 WP_001155264.1.77298 WP_001155264.1.77331 WP_001155264.1.77346 WP_001155264.1.77359 WP_001155264.1.77388 WP_001155264.1.77498 WP_001155264.1.77650 WP_001155264.1.77735 WP_001155264.1.77791 WP_001155264.1.7785 WP_001155264.1.7786 WP_001155264.1.77882 WP_001155264.1.77893 WP_001155264.1.77922 WP_001155264.1.77930 WP_001155264.1.77986 WP_001155264.1.78082 WP_001155264.1.78093 WP_001155264.1.78164 WP_001155264.1.78179 WP_001155264.1.78194 WP_001155264.1.78304 WP_001155264.1.78330 WP_001155264.1.78335 WP_001155264.1.78371 WP_001155264.1.78434 WP_001155264.1.78470 WP_001155264.1.78489 WP_001155264.1.78494 WP_001155264.1.78573 WP_001155264.1.78585 WP_001155264.1.78592 WP_001155264.1.78662 WP_001155264.1.78685 WP_001155264.1.78736 WP_001155264.1.78758 WP_001155264.1.78816 WP_001155264.1.78920 WP_001155264.1.78937 WP_001155264.1.78995 WP_001155264.1.7905 WP_001155264.1.79110 WP_001155264.1.7914 WP_001155264.1.79143 WP_001155264.1.79192 WP_001155264.1.79275 WP_001155264.1.79285 WP_001155264.1.79378 WP_001155264.1.79552 WP_001155264.1.79581 WP_001155264.1.79627 WP_001155264.1.79677 WP_001155264.1.79731 WP_001155264.1.79763 WP_001155264.1.7981 WP_001155264.1.79815 WP_001155264.1.79904 WP_001155264.1.79949 WP_001155264.1.80009 WP_001155264.1.80013 WP_001155264.1.80029 WP_001155264.1.80086 WP_001155264.1.80119 WP_001155264.1.80120 WP_001155264.1.80122 WP_001155264.1.80146 WP_001155264.1.80178 WP_001155264.1.80184 WP_001155264.1.80210 WP_001155264.1.80274 WP_001155264.1.80316 WP_001155264.1.80361 WP_001155264.1.80389 WP_001155264.1.8040 WP_001155264.1.8045 WP_001155264.1.80521 WP_001155264.1.80582 WP_001155264.1.80745 WP_001155264.1.80899 WP_001155264.1.81022 WP_001155264.1.81049 WP_001155264.1.81052 WP_001155264.1.81064 WP_001155264.1.81095 WP_001155264.1.81132 WP_001155264.1.81151 WP_001155264.1.81172 WP_001155264.1.81176 WP_001155264.1.81184 WP_001155264.1.81214 WP_001155264.1.81228 WP_001155264.1.81232 WP_001155264.1.81288 WP_001155264.1.81290 WP_001155264.1.81379 WP_001155264.1.81508 WP_001155264.1.81574 WP_001155264.1.8160 WP_001155264.1.81604 WP_001155264.1.81619 WP_001155264.1.81645 WP_001155264.1.8180 WP_001155264.1.81837 WP_001155264.1.81838 WP_001155264.1.8185 WP_001155264.1.81969 WP_001155264.1.81990 WP_001155264.1.8206 WP_001155264.1.82103 WP_001155264.1.8213 WP_001155264.1.82174 WP_001155264.1.82184 WP_001155264.1.82253 WP_001155264.1.82281 WP_001155264.1.82349 WP_001155264.1.82406 WP_001155264.1.82458 WP_001155264.1.82468 WP_001155264.1.82525 WP_001155264.1.82535 WP_001155264.1.82558 WP_001155264.1.82678 WP_001155264.1.82768 WP_001155264.1.82824 WP_001155264.1.82855 WP_001155264.1.82930 WP_001155264.1.82941 WP_001155264.1.83046 WP_001155264.1.83054 WP_001155264.1.83078 WP_001155264.1.83086 WP_001155264.1.83103 WP_001155264.1.8318 WP_001155264.1.83203 WP_001155264.1.83291 WP_001155264.1.83359 WP_001155264.1.83405 WP_001155264.1.8346 WP_001155264.1.83467 WP_001155264.1.83472 WP_001155264.1.83479 WP_001155264.1.83520 WP_001155264.1.83553 WP_001155264.1.8366 WP_001155264.1.83674 WP_001155264.1.83728 WP_001155264.1.83750 WP_001155264.1.83756 WP_001155264.1.83758 WP_001155264.1.83788 WP_001155264.1.83844 WP_001155264.1.8385 WP_001155264.1.83886 WP_001155264.1.83989 WP_001155264.1.84025 WP_001155264.1.84054 WP_001155264.1.84118 WP_001155264.1.84129 WP_001155264.1.84161 WP_001155264.1.84188 WP_001155264.1.84275 WP_001155264.1.84415 WP_001155264.1.84418 WP_001155264.1.84590 WP_001155264.1.84596 WP_001155264.1.84608 WP_001155264.1.8462 WP_001155264.1.84648 WP_001155264.1.84696 WP_001155264.1.84826 WP_001155264.1.84847 WP_001155264.1.84924 WP_001155264.1.8496 WP_001155264.1.84975 WP_001155264.1.84978 WP_001155264.1.85017 WP_001155264.1.85026 WP_001155264.1.85045 WP_001155264.1.85070 WP_001155264.1.85118 WP_001155264.1.85229 WP_001155264.1.85289 WP_001155264.1.85375 WP_001155264.1.85376 WP_001155264.1.85409 WP_001155264.1.85441 WP_001155264.1.85485 WP_001155264.1.85585 WP_001155264.1.85611 WP_001155264.1.85730 WP_001155264.1.85732 WP_001155264.1.85858 WP_001155264.1.85906 WP_001155264.1.85924 WP_001155264.1.85971 WP_001155264.1.85980 WP_001155264.1.86036 WP_001155264.1.86042 WP_001155264.1.862 WP_001155264.1.86209 WP_001155264.1.86281 WP_001155264.1.86315 WP_001155264.1.8636 WP_001155264.1.86363 WP_001155264.1.86390 WP_001155264.1.86531 WP_001155264.1.86664 WP_001155264.1.86704 WP_001155264.1.86736 WP_001155264.1.86745 WP_001155264.1.86779 WP_001155264.1.86793 WP_001155264.1.86795 WP_001155264.1.8690 WP_001155264.1.86968 WP_001155264.1.86999 WP_001155264.1.87088 WP_001155264.1.87097 WP_001155264.1.87100 WP_001155264.1.87133 WP_001155264.1.87137 WP_001155264.1.87190 WP_001155264.1.87221 WP_001155264.1.87296 WP_001155264.1.87363 WP_001155264.1.87372 WP_001155264.1.87388 WP_001155264.1.87486 WP_001155264.1.87511 WP_001155264.1.87541 WP_001155264.1.87595 WP_001155264.1.8764 WP_001155264.1.87734 WP_001155264.1.87745 WP_001155264.1.87841 WP_001155264.1.87854 WP_001155264.1.87865 WP_001155264.1.87937 WP_001155264.1.87967 WP_001155264.1.88169 WP_001155264.1.88309 WP_001155264.1.88375 WP_001155264.1.88418 WP_001155264.1.88440 WP_001155264.1.88449 WP_001155264.1.8847 WP_001155264.1.88563 WP_001155264.1.88585 WP_001155264.1.8859 WP_001155264.1.88600 WP_001155264.1.88614 WP_001155264.1.88696 WP_001155264.1.88771 WP_001155264.1.88781 WP_001155264.1.88843 WP_001155264.1.88878 WP_001155264.1.88954 WP_001155264.1.88962 WP_001155264.1.89012 WP_001155264.1.89024 WP_001155264.1.89036 WP_001155264.1.89125 WP_001155264.1.89164 WP_001155264.1.8918 WP_001155264.1.89184 WP_001155264.1.89262 WP_001155264.1.89290 WP_001155264.1.89348 WP_001155264.1.89350 WP_001155264.1.89404 WP_001155264.1.89779 WP_001155264.1.89794 WP_001155264.1.898 WP_001155264.1.89863 WP_001155264.1.89908 WP_001155264.1.89950 WP_001155264.1.90069 WP_001155264.1.90173 WP_001155264.1.90174 WP_001155264.1.90217 WP_001155264.1.90246 WP_001155264.1.90250 WP_001155264.1.90386 WP_001155264.1.90447 WP_001155264.1.90454 WP_001155264.1.90475 WP_001155264.1.90488 WP_001155264.1.90506 WP_001155264.1.90533 WP_001155264.1.90556 WP_001155264.1.90661 WP_001155264.1.90698 WP_001155264.1.9076 WP_001155264.1.91005 WP_001155264.1.91019 WP_001155264.1.91150 WP_001155264.1.9122 WP_001155264.1.91280 WP_001155264.1.91287 WP_001155264.1.91371 WP_001155264.1.91447 WP_001155264.1.91486 WP_001155264.1.91525 WP_001155264.1.91530 WP_001155264.1.9155 WP_001155264.1.91586 WP_001155264.1.91611 WP_001155264.1.91634 WP_001155264.1.91670 WP_001155264.1.917 WP_001155264.1.91704 WP_001155264.1.91745 WP_001155264.1.91848 WP_001155264.1.91969 WP_001155264.1.92125 WP_001155264.1.92186 WP_001155264.1.92212 WP_001155264.1.92228 WP_001155264.1.92244 WP_001155264.1.92249 WP_001155264.1.92303 WP_001155264.1.92391 WP_001155264.1.92405 WP_001155264.1.92425 WP_001155264.1.9247 WP_001155264.1.92512 WP_001155264.1.92667 WP_001155264.1.92674 WP_001155264.1.92718 WP_001155264.1.92765 WP_001155264.1.92795 WP_001155264.1.9286 WP_001155264.1.9296 WP_001155264.1.92965 WP_001155264.1.92997 WP_001155264.1.93047 WP_001155264.1.93071 WP_001155264.1.93147 WP_001155264.1.93197 WP_001155264.1.93243 WP_001155264.1.93254 WP_001155264.1.93260 WP_001155264.1.93378 WP_001155264.1.93471 WP_001155264.1.93567 WP_001155264.1.93579 WP_001155264.1.93708 WP_001155264.1.93758 WP_001155264.1.93762 WP_001155264.1.93775 WP_001155264.1.93890 WP_001155264.1.94 WP_001155264.1.94053 WP_001155264.1.94080 WP_001155264.1.94122 WP_001155264.1.94123 WP_001155264.1.94130 WP_001155264.1.94242 WP_001155264.1.94248 WP_001155264.1.94268 WP_001155264.1.94287 WP_001155264.1.9430 WP_001155264.1.94320 WP_001155264.1.94324 WP_001155264.1.94337 WP_001155264.1.94341 WP_001155264.1.94484 WP_001155264.1.94505 WP_001155264.1.94536 WP_001155264.1.9455 WP_001155264.1.947 WP_001155264.1.94825 WP_001155264.1.94969 WP_001155264.1.95008 WP_001155264.1.95023 WP_001155264.1.95029 WP_001155264.1.95033 WP_001155264.1.95156 WP_001155264.1.95193 WP_001155264.1.95263 WP_001155264.1.95294 WP_001155264.1.95386 WP_001155264.1.95415 WP_001155264.1.95494 WP_001155264.1.95512 WP_001155264.1.95519 WP_001155264.1.95522 WP_001155264.1.95560 WP_001155264.1.9563 WP_001155264.1.95683 WP_001155264.1.95780 WP_001155264.1.95804 WP_001155264.1.95832 WP_001155264.1.959 WP_001155264.1.95962 WP_001155264.1.96160 WP_001155264.1.96163 WP_001155264.1.96209 WP_001155264.1.96218 WP_001155264.1.96271 WP_001155264.1.96305 WP_001155264.1.96316 WP_001155264.1.96468 WP_001155264.1.96568 WP_001155264.1.96646 WP_001155264.1.96688 WP_001155264.1.96727 WP_001155264.1.96770 WP_001155264.1.96804 WP_001155264.1.96895 WP_001155264.1.96918 WP_001155264.1.9695 WP_001155264.1.96976 WP_001155264.1.97001 WP_001155264.1.97007 WP_001155264.1.97072 WP_001155264.1.97117 WP_001155264.1.97138 WP_001155264.1.97191 WP_001155264.1.97267 WP_001155264.1.97295 WP_001155264.1.97411 WP_001155264.1.97536 WP_001155264.1.97574 WP_001155264.1.97627 WP_001155264.1.97731 WP_001155264.1.97739 WP_001155264.1.97758 WP_001155264.1.97786 WP_001155264.1.97827 WP_001155264.1.9789 WP_001155264.1.97899 WP_001155264.1.97928 WP_001155264.1.97999 WP_001155264.1.98011 WP_001155264.1.98033 WP_001155264.1.98051 WP_001155264.1.98361 WP_001155264.1.98379 WP_001155264.1.98411 WP_001155264.1.98456 WP_001155264.1.98512 WP_001155264.1.98552 WP_001155264.1.986 WP_001155264.1.98655 WP_001155264.1.98706 WP_001155264.1.98767 WP_001155264.1.98837 WP_001155264.1.98858 WP_001155264.1.98874 WP_001155264.1.98967 WP_001155264.1.99009 WP_001155264.1.99025 WP_001155264.1.99155 WP_001155264.1.99171 WP_001155264.1.99249 WP_001155264.1.99280 WP_001155264.1.9936 WP_001155264.1.99430 WP_001155264.1.99459 WP_001155264.1.99492 WP_001155264.1.99494 WP_001155264.1.99519 WP_001155264.1.99536 WP_001155264.1.99538 WP_001155264.1.99564 WP_001155264.1.99569 WP_001155264.1.9960 WP_001155264.1.99631 WP_001155264.1.99638 WP_001155264.1.99686 WP_001155264.1.99759 WP_001155264.1.99802 WP_001155264.1.99850 WP_001155264.1.99860 WP_001155264.1.9987 WP_001155264.1.99888 WP_001155264.1.99956 WP_001155264.1.99979 WP_001155264.1.99985 YP_501044.1.76163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]