SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|49485067|ref|YP_042288.1| from Staphylococcus aureus subsp. aureus MSSA476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49485067|ref|YP_042288.1|
Domain Number 1 Region: 6-245
Classification Level Classification E-value
Superfamily SIS domain 1.31e-67
Family mono-SIS domain 0.000000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|49485067|ref|YP_042288.1|
Sequence length 299
Comment N-acetylmuramic acid 6-phosphate etherase [Staphylococcus aureus subsp. aureus MSSA476]
Sequence
MMENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIPQLTKVIKKTIAQYKK
GGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHAMTMAVEGAEDHKKLAE
EDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFANTIGATTVSISCNEHAVISEIAQYPVE
VKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNLMIDVKATNQKLIDRSVRI
IQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATRRLLNNGDIVKRAIRDRQP
Download sequence
Identical sequences A0A0H3K698 Q2FK71 Q2G1G6 Q5HJI1 Q6GCT5 Q6GKB5 Q7A1Y2 Q7A805 Q99X30
gi|15923181|ref|NP_370715.1| gi|15925895|ref|NP_373428.1| gi|156978521|ref|YP_001440780.1| gi|151220347|ref|YP_001331170.1| gi|49485067|ref|YP_042288.1| gi|21281894|ref|NP_644980.1| 158878.SAV0191 158879.SA0185 196620.MW0165 282458.SAR0192 282459.SAS0166 418127.SAHV_0190 426430.NWMN_0135 93062.SACOL0177 gi|49482433|ref|YP_039657.1| gi|386829874|ref|YP_006236528.1| gi|57651193|ref|YP_185076.1| gi|387149377|ref|YP_005740941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]