SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|49485436|ref|YP_042657.1| from Staphylococcus aureus subsp. aureus MSSA476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49485436|ref|YP_042657.1|
Domain Number 1 Region: 8-181
Classification Level Classification E-value
Superfamily SIS domain 1.78e-35
Family mono-SIS domain 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|49485436|ref|YP_042657.1|
Sequence length 182
Comment 6-phospho 3-hexuloisomerase [Staphylococcus aureus subsp. aureus MSSA476]
Sequence
MAEFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQ
LGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIG
NLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHAN
LE
Download sequence
Identical sequences A0A0E1VLM7 A0A0H3JUQ9 A0A2H4QKF8
196620.MW0526 282459.SAS0529 gi|49485436|ref|YP_042657.1| gi|385780837|ref|YP_005757008.1| gi|21282255|ref|NP_645343.1| WP_000807389.1.101330 WP_000807389.1.101406 WP_000807389.1.101598 WP_000807389.1.102066 WP_000807389.1.102070 WP_000807389.1.10928 WP_000807389.1.11228 WP_000807389.1.13317 WP_000807389.1.1457 WP_000807389.1.14924 WP_000807389.1.15241 WP_000807389.1.15478 WP_000807389.1.15601 WP_000807389.1.15753 WP_000807389.1.17050 WP_000807389.1.18527 WP_000807389.1.18567 WP_000807389.1.19022 WP_000807389.1.19575 WP_000807389.1.2 WP_000807389.1.20690 WP_000807389.1.22180 WP_000807389.1.23439 WP_000807389.1.2434 WP_000807389.1.24503 WP_000807389.1.24685 WP_000807389.1.25262 WP_000807389.1.28866 WP_000807389.1.28915 WP_000807389.1.29315 WP_000807389.1.29554 WP_000807389.1.29716 WP_000807389.1.30458 WP_000807389.1.30496 WP_000807389.1.31212 WP_000807389.1.31426 WP_000807389.1.31505 WP_000807389.1.33765 WP_000807389.1.34128 WP_000807389.1.34334 WP_000807389.1.36932 WP_000807389.1.36983 WP_000807389.1.38100 WP_000807389.1.38390 WP_000807389.1.38862 WP_000807389.1.38960 WP_000807389.1.40299 WP_000807389.1.41647 WP_000807389.1.43331 WP_000807389.1.43530 WP_000807389.1.43683 WP_000807389.1.44899 WP_000807389.1.45132 WP_000807389.1.45620 WP_000807389.1.46195 WP_000807389.1.47090 WP_000807389.1.47493 WP_000807389.1.47541 WP_000807389.1.47629 WP_000807389.1.5108 WP_000807389.1.53323 WP_000807389.1.53418 WP_000807389.1.54446 WP_000807389.1.57196 WP_000807389.1.57723 WP_000807389.1.58321 WP_000807389.1.58419 WP_000807389.1.58495 WP_000807389.1.58538 WP_000807389.1.61009 WP_000807389.1.61897 WP_000807389.1.63068 WP_000807389.1.63215 WP_000807389.1.63322 WP_000807389.1.64598 WP_000807389.1.64994 WP_000807389.1.65046 WP_000807389.1.65600 WP_000807389.1.6612 WP_000807389.1.74273 WP_000807389.1.74761 WP_000807389.1.74846 WP_000807389.1.76149 WP_000807389.1.78598 WP_000807389.1.79270 WP_000807389.1.80855 WP_000807389.1.81010 WP_000807389.1.81384 WP_000807389.1.83066 WP_000807389.1.83508 WP_000807389.1.85160 WP_000807389.1.85292 WP_000807389.1.8551 WP_000807389.1.8617 WP_000807389.1.86606 WP_000807389.1.87272 WP_000807389.1.88560 WP_000807389.1.88753 WP_000807389.1.88761 WP_000807389.1.90517 WP_000807389.1.9055 WP_000807389.1.9071 WP_000807389.1.90923 WP_000807389.1.92918 WP_000807389.1.92960 WP_000807389.1.93237 WP_000807389.1.93736 WP_000807389.1.96882 WP_000807389.1.97017 WP_000807389.1.97019 WP_000807389.1.97444 WP_000807389.1.97468 WP_000807389.1.98497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]