SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|49485738|ref|YP_042959.1| from Staphylococcus aureus subsp. aureus MSSA476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49485738|ref|YP_042959.1|
Domain Number 1 Region: 4-442
Classification Level Classification E-value
Superfamily SIS domain 5.11e-139
Family Phosphoglucose isomerase, PGI 0.0000000000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|49485738|ref|YP_042959.1|
Sequence length 443
Comment glucose-6-phosphate isomerase [Staphylococcus aureus subsp. aureus MSSA476]
Sequence
MTHIQLDFSKTLEFFGEHELKQQQEIVKSIHKTIHEGTGAGSDFLGWVDLPVDYDKEEFS
RIVEASKRIKENSDVLVVIGIGGSYLGARAAIEMLTSSFRNSNEYPEIVFVGNHLSSTYT
KELVDYLADKDFSVNVISKSGTTTEPAVAFRLFKQLVEERYGKEEAQKRIFATTDKEKGA
LKQLATNEGYETFIVPDDVGGRYSVLTAVGLLPIATAGINIEAMMIGAAKAREELSSDKL
EENIAYQYATIRNILYAKGYTTEMLINYEPSMQYFNEWWKQLFGESEGKDFKGIYPSSAN
YTTDLHSLGQYVQEGRRFLFETVVKVNHPKYDITIEKDSDDLDGLNYLAGKTIDEVNTKA
FEGTLLAHTDGGVPNMVVNIPQLDEETFGYVVYFFELACAMSGYQLGVNPFNQPGVEAYK
QNMFALLGKPGFEDLKKELEERL
Download sequence
Identical sequences A0A0E1X754 A0A1E8WPI5 A0A2K1ABS4 A6QFH3 Q2FIB3 Q5HHC2 Q6GAW4 Q6GIC6 Q8NXF1 X5E018
d3ff1a1 d3ff1b1 gi|57651654|ref|YP_185835.1| gi|384547152|ref|YP_005736405.1| gi|385781192|ref|YP_005757363.1| gi|384549726|ref|YP_005738978.1| gi|49485738|ref|YP_042959.1| gi|514065825|ref|YP_008127745.1| gi|49483122|ref|YP_040346.1| WP_000148855.1.100013 WP_000148855.1.100041 WP_000148855.1.100049 WP_000148855.1.100057 WP_000148855.1.100067 WP_000148855.1.100072 WP_000148855.1.100084 WP_000148855.1.100088 WP_000148855.1.100094 WP_000148855.1.100117 WP_000148855.1.100122 WP_000148855.1.100154 WP_000148855.1.100180 WP_000148855.1.100189 WP_000148855.1.100298 WP_000148855.1.100307 WP_000148855.1.100384 WP_000148855.1.100391 WP_000148855.1.10041 WP_000148855.1.100551 WP_000148855.1.100618 WP_000148855.1.100631 WP_000148855.1.100647 WP_000148855.1.100761 WP_000148855.1.100768 WP_000148855.1.100834 WP_000148855.1.10085 WP_000148855.1.100903 WP_000148855.1.100920 WP_000148855.1.100963 WP_000148855.1.100981 WP_000148855.1.100987 WP_000148855.1.101017 WP_000148855.1.101084 WP_000148855.1.101177 WP_000148855.1.101240 WP_000148855.1.101266 WP_000148855.1.101298 WP_000148855.1.101327 WP_000148855.1.101330 WP_000148855.1.101375 WP_000148855.1.101393 WP_000148855.1.101406 WP_000148855.1.101458 WP_000148855.1.101490 WP_000148855.1.101505 WP_000148855.1.101566 WP_000148855.1.101570 WP_000148855.1.101598 WP_000148855.1.101615 WP_000148855.1.10166 WP_000148855.1.101725 WP_000148855.1.101758 WP_000148855.1.101775 WP_000148855.1.101788 WP_000148855.1.101950 WP_000148855.1.102066 WP_000148855.1.102070 WP_000148855.1.1022 WP_000148855.1.10232 WP_000148855.1.10397 WP_000148855.1.10408 WP_000148855.1.10431 WP_000148855.1.10503 WP_000148855.1.10542 WP_000148855.1.10565 WP_000148855.1.10614 WP_000148855.1.10644 WP_000148855.1.10679 WP_000148855.1.10707 WP_000148855.1.10726 WP_000148855.1.10742 WP_000148855.1.10783 WP_000148855.1.10841 WP_000148855.1.10928 WP_000148855.1.10950 WP_000148855.1.10969 WP_000148855.1.1097 WP_000148855.1.11067 WP_000148855.1.11076 WP_000148855.1.11129 WP_000148855.1.1120 WP_000148855.1.11228 WP_000148855.1.11234 WP_000148855.1.11294 WP_000148855.1.11348 WP_000148855.1.11353 WP_000148855.1.11377 WP_000148855.1.11407 WP_000148855.1.11488 WP_000148855.1.11492 WP_000148855.1.11525 WP_000148855.1.11558 WP_000148855.1.11592 WP_000148855.1.11625 WP_000148855.1.11665 WP_000148855.1.11692 WP_000148855.1.117 WP_000148855.1.11719 WP_000148855.1.11720 WP_000148855.1.11795 WP_000148855.1.11829 WP_000148855.1.11894 WP_000148855.1.11991 WP_000148855.1.1205 WP_000148855.1.12073 WP_000148855.1.12098 WP_000148855.1.12123 WP_000148855.1.12158 WP_000148855.1.12181 WP_000148855.1.12193 WP_000148855.1.12194 WP_000148855.1.12233 WP_000148855.1.12297 WP_000148855.1.12328 WP_000148855.1.12447 WP_000148855.1.12498 WP_000148855.1.1252 WP_000148855.1.1253 WP_000148855.1.12555 WP_000148855.1.12597 WP_000148855.1.12639 WP_000148855.1.12715 WP_000148855.1.12771 WP_000148855.1.12822 WP_000148855.1.12833 WP_000148855.1.12845 WP_000148855.1.12862 WP_000148855.1.12903 WP_000148855.1.12937 WP_000148855.1.12938 WP_000148855.1.12977 WP_000148855.1.13039 WP_000148855.1.13072 WP_000148855.1.13091 WP_000148855.1.13104 WP_000148855.1.13164 WP_000148855.1.13228 WP_000148855.1.13303 WP_000148855.1.13307 WP_000148855.1.13317 WP_000148855.1.13322 WP_000148855.1.13336 WP_000148855.1.13468 WP_000148855.1.1347 WP_000148855.1.13486 WP_000148855.1.13505 WP_000148855.1.13531 WP_000148855.1.13556 WP_000148855.1.13568 WP_000148855.1.13617 WP_000148855.1.13654 WP_000148855.1.13680 WP_000148855.1.13683 WP_000148855.1.13709 WP_000148855.1.13727 WP_000148855.1.1374 WP_000148855.1.13755 WP_000148855.1.13757 WP_000148855.1.13772 WP_000148855.1.13804 WP_000148855.1.13805 WP_000148855.1.13807 WP_000148855.1.13940 WP_000148855.1.13983 WP_000148855.1.14010 WP_000148855.1.14071 WP_000148855.1.14076 WP_000148855.1.14112 WP_000148855.1.14153 WP_000148855.1.14221 WP_000148855.1.14233 WP_000148855.1.1426 WP_000148855.1.14272 WP_000148855.1.14314 WP_000148855.1.14364 WP_000148855.1.14366 WP_000148855.1.14394 WP_000148855.1.14418 WP_000148855.1.14475 WP_000148855.1.14546 WP_000148855.1.1457 WP_000148855.1.14666 WP_000148855.1.1468 WP_000148855.1.147 WP_000148855.1.14744 WP_000148855.1.1477 WP_000148855.1.14790 WP_000148855.1.14809 WP_000148855.1.14869 WP_000148855.1.14888 WP_000148855.1.14902 WP_000148855.1.14987 WP_000148855.1.15091 WP_000148855.1.15098 WP_000148855.1.15241 WP_000148855.1.15263 WP_000148855.1.15278 WP_000148855.1.15329 WP_000148855.1.15399 WP_000148855.1.15409 WP_000148855.1.15438 WP_000148855.1.1545 WP_000148855.1.15489 WP_000148855.1.15505 WP_000148855.1.15524 WP_000148855.1.15572 WP_000148855.1.15601 WP_000148855.1.15641 WP_000148855.1.15687 WP_000148855.1.15706 WP_000148855.1.15712 WP_000148855.1.15753 WP_000148855.1.1579 WP_000148855.1.15818 WP_000148855.1.1583 WP_000148855.1.15838 WP_000148855.1.1586 WP_000148855.1.15883 WP_000148855.1.15892 WP_000148855.1.15897 WP_000148855.1.15898 WP_000148855.1.15928 WP_000148855.1.15939 WP_000148855.1.15957 WP_000148855.1.15972 WP_000148855.1.1600 WP_000148855.1.16026 WP_000148855.1.1606 WP_000148855.1.16083 WP_000148855.1.16112 WP_000148855.1.16213 WP_000148855.1.16214 WP_000148855.1.16237 WP_000148855.1.16362 WP_000148855.1.16372 WP_000148855.1.16408 WP_000148855.1.16414 WP_000148855.1.16417 WP_000148855.1.16554 WP_000148855.1.16564 WP_000148855.1.16569 WP_000148855.1.16603 WP_000148855.1.16617 WP_000148855.1.16628 WP_000148855.1.1666 WP_000148855.1.16672 WP_000148855.1.16688 WP_000148855.1.16703 WP_000148855.1.16768 WP_000148855.1.16770 WP_000148855.1.16776 WP_000148855.1.16802 WP_000148855.1.16892 WP_000148855.1.16946 WP_000148855.1.17038 WP_000148855.1.17050 WP_000148855.1.17104 WP_000148855.1.17137 WP_000148855.1.17156 WP_000148855.1.17169 WP_000148855.1.17210 WP_000148855.1.17231 WP_000148855.1.17234 WP_000148855.1.17249 WP_000148855.1.17256 WP_000148855.1.17296 WP_000148855.1.17320 WP_000148855.1.17450 WP_000148855.1.17456 WP_000148855.1.17485 WP_000148855.1.1751 WP_000148855.1.17524 WP_000148855.1.17581 WP_000148855.1.17666 WP_000148855.1.17676 WP_000148855.1.17770 WP_000148855.1.17834 WP_000148855.1.17845 WP_000148855.1.17859 WP_000148855.1.17876 WP_000148855.1.17929 WP_000148855.1.17951 WP_000148855.1.18016 WP_000148855.1.18035 WP_000148855.1.18074 WP_000148855.1.18105 WP_000148855.1.1811 WP_000148855.1.18132 WP_000148855.1.18283 WP_000148855.1.18290 WP_000148855.1.18320 WP_000148855.1.1835 WP_000148855.1.18424 WP_000148855.1.18437 WP_000148855.1.18451 WP_000148855.1.1849 WP_000148855.1.185 WP_000148855.1.1851 WP_000148855.1.18516 WP_000148855.1.18526 WP_000148855.1.18527 WP_000148855.1.18529 WP_000148855.1.18562 WP_000148855.1.18567 WP_000148855.1.18605 WP_000148855.1.18611 WP_000148855.1.18658 WP_000148855.1.18668 WP_000148855.1.18758 WP_000148855.1.18799 WP_000148855.1.18809 WP_000148855.1.18830 WP_000148855.1.18836 WP_000148855.1.18870 WP_000148855.1.18879 WP_000148855.1.18918 WP_000148855.1.18938 WP_000148855.1.18987 WP_000148855.1.19009 WP_000148855.1.1901 WP_000148855.1.19022 WP_000148855.1.19027 WP_000148855.1.1912 WP_000148855.1.19149 WP_000148855.1.19179 WP_000148855.1.192 WP_000148855.1.19259 WP_000148855.1.19272 WP_000148855.1.19370 WP_000148855.1.19399 WP_000148855.1.1940 WP_000148855.1.19411 WP_000148855.1.19444 WP_000148855.1.19509 WP_000148855.1.19575 WP_000148855.1.19733 WP_000148855.1.1975 WP_000148855.1.19765 WP_000148855.1.19775 WP_000148855.1.19904 WP_000148855.1.19928 WP_000148855.1.19977 WP_000148855.1.20057 WP_000148855.1.20101 WP_000148855.1.2013 WP_000148855.1.20155 WP_000148855.1.20160 WP_000148855.1.20201 WP_000148855.1.20235 WP_000148855.1.20307 WP_000148855.1.20386 WP_000148855.1.20473 WP_000148855.1.20496 WP_000148855.1.20500 WP_000148855.1.20550 WP_000148855.1.20554 WP_000148855.1.20661 WP_000148855.1.20690 WP_000148855.1.20698 WP_000148855.1.20772 WP_000148855.1.2079 WP_000148855.1.20833 WP_000148855.1.20838 WP_000148855.1.20860 WP_000148855.1.20975 WP_000148855.1.21013 WP_000148855.1.21031 WP_000148855.1.21054 WP_000148855.1.21080 WP_000148855.1.2128 WP_000148855.1.2129 WP_000148855.1.21312 WP_000148855.1.21356 WP_000148855.1.21386 WP_000148855.1.21402 WP_000148855.1.21465 WP_000148855.1.21477 WP_000148855.1.2154 WP_000148855.1.21583 WP_000148855.1.21601 WP_000148855.1.21679 WP_000148855.1.21712 WP_000148855.1.21820 WP_000148855.1.21828 WP_000148855.1.21890 WP_000148855.1.21901 WP_000148855.1.21919 WP_000148855.1.22163 WP_000148855.1.22165 WP_000148855.1.22170 WP_000148855.1.22174 WP_000148855.1.22246 WP_000148855.1.22307 WP_000148855.1.22344 WP_000148855.1.22367 WP_000148855.1.22512 WP_000148855.1.22526 WP_000148855.1.22551 WP_000148855.1.22657 WP_000148855.1.22684 WP_000148855.1.22714 WP_000148855.1.22730 WP_000148855.1.22731 WP_000148855.1.22787 WP_000148855.1.2280 WP_000148855.1.22811 WP_000148855.1.22843 WP_000148855.1.22859 WP_000148855.1.22861 WP_000148855.1.23004 WP_000148855.1.23152 WP_000148855.1.23194 WP_000148855.1.23222 WP_000148855.1.23228 WP_000148855.1.23238 WP_000148855.1.23381 WP_000148855.1.23420 WP_000148855.1.23439 WP_000148855.1.23450 WP_000148855.1.23491 WP_000148855.1.23541 WP_000148855.1.23544 WP_000148855.1.23557 WP_000148855.1.23586 WP_000148855.1.23613 WP_000148855.1.23617 WP_000148855.1.23626 WP_000148855.1.23822 WP_000148855.1.23849 WP_000148855.1.23907 WP_000148855.1.23935 WP_000148855.1.23998 WP_000148855.1.24148 WP_000148855.1.24167 WP_000148855.1.2423 WP_000148855.1.24241 WP_000148855.1.24279 WP_000148855.1.2434 WP_000148855.1.24347 WP_000148855.1.24364 WP_000148855.1.24388 WP_000148855.1.24418 WP_000148855.1.2442 WP_000148855.1.24443 WP_000148855.1.24478 WP_000148855.1.24502 WP_000148855.1.24503 WP_000148855.1.2458 WP_000148855.1.24597 WP_000148855.1.24617 WP_000148855.1.24644 WP_000148855.1.24681 WP_000148855.1.24702 WP_000148855.1.24745 WP_000148855.1.24780 WP_000148855.1.24781 WP_000148855.1.2480 WP_000148855.1.24802 WP_000148855.1.24817 WP_000148855.1.24856 WP_000148855.1.24891 WP_000148855.1.24918 WP_000148855.1.25083 WP_000148855.1.25117 WP_000148855.1.25170 WP_000148855.1.25187 WP_000148855.1.25331 WP_000148855.1.25438 WP_000148855.1.2544 WP_000148855.1.25469 WP_000148855.1.25479 WP_000148855.1.25495 WP_000148855.1.25511 WP_000148855.1.25567 WP_000148855.1.25591 WP_000148855.1.25593 WP_000148855.1.25597 WP_000148855.1.25634 WP_000148855.1.25737 WP_000148855.1.25744 WP_000148855.1.25770 WP_000148855.1.2579 WP_000148855.1.25801 WP_000148855.1.25820 WP_000148855.1.25868 WP_000148855.1.25881 WP_000148855.1.25891 WP_000148855.1.25924 WP_000148855.1.2593 WP_000148855.1.26006 WP_000148855.1.26012 WP_000148855.1.26015 WP_000148855.1.262 WP_000148855.1.26293 WP_000148855.1.26306 WP_000148855.1.26307 WP_000148855.1.26315 WP_000148855.1.26370 WP_000148855.1.26481 WP_000148855.1.2656 WP_000148855.1.2658 WP_000148855.1.2661 WP_000148855.1.26626 WP_000148855.1.2664 WP_000148855.1.26650 WP_000148855.1.26663 WP_000148855.1.26733 WP_000148855.1.26771 WP_000148855.1.26790 WP_000148855.1.26886 WP_000148855.1.26927 WP_000148855.1.26958 WP_000148855.1.27097 WP_000148855.1.27120 WP_000148855.1.27127 WP_000148855.1.27154 WP_000148855.1.27199 WP_000148855.1.27246 WP_000148855.1.27311 WP_000148855.1.27333 WP_000148855.1.2734 WP_000148855.1.27345 WP_000148855.1.27415 WP_000148855.1.27448 WP_000148855.1.27455 WP_000148855.1.27457 WP_000148855.1.27516 WP_000148855.1.27551 WP_000148855.1.27562 WP_000148855.1.2759 WP_000148855.1.27608 WP_000148855.1.27614 WP_000148855.1.27615 WP_000148855.1.27621 WP_000148855.1.27622 WP_000148855.1.27654 WP_000148855.1.27662 WP_000148855.1.27667 WP_000148855.1.27670 WP_000148855.1.27673 WP_000148855.1.27748 WP_000148855.1.27787 WP_000148855.1.27817 WP_000148855.1.27854 WP_000148855.1.27950 WP_000148855.1.27972 WP_000148855.1.27999 WP_000148855.1.28007 WP_000148855.1.28063 WP_000148855.1.28071 WP_000148855.1.28081 WP_000148855.1.28088 WP_000148855.1.28117 WP_000148855.1.28138 WP_000148855.1.28147 WP_000148855.1.28158 WP_000148855.1.28191 WP_000148855.1.28207 WP_000148855.1.28298 WP_000148855.1.28358 WP_000148855.1.28360 WP_000148855.1.28376 WP_000148855.1.28381 WP_000148855.1.28388 WP_000148855.1.28498 WP_000148855.1.28502 WP_000148855.1.28526 WP_000148855.1.28527 WP_000148855.1.28532 WP_000148855.1.28629 WP_000148855.1.28650 WP_000148855.1.28672 WP_000148855.1.28675 WP_000148855.1.28691 WP_000148855.1.28710 WP_000148855.1.28862 WP_000148855.1.28866 WP_000148855.1.28874 WP_000148855.1.28887 WP_000148855.1.28915 WP_000148855.1.28933 WP_000148855.1.28934 WP_000148855.1.28960 WP_000148855.1.28970 WP_000148855.1.29014 WP_000148855.1.29107 WP_000148855.1.29170 WP_000148855.1.29188 WP_000148855.1.29207 WP_000148855.1.29250 WP_000148855.1.29272 WP_000148855.1.29282 WP_000148855.1.29285 WP_000148855.1.29312 WP_000148855.1.29315 WP_000148855.1.29372 WP_000148855.1.29373 WP_000148855.1.29381 WP_000148855.1.29445 WP_000148855.1.29511 WP_000148855.1.29541 WP_000148855.1.29557 WP_000148855.1.29561 WP_000148855.1.29596 WP_000148855.1.29644 WP_000148855.1.29676 WP_000148855.1.29716 WP_000148855.1.2975 WP_000148855.1.29758 WP_000148855.1.29781 WP_000148855.1.29805 WP_000148855.1.29826 WP_000148855.1.29885 WP_000148855.1.29956 WP_000148855.1.29963 WP_000148855.1.30012 WP_000148855.1.30033 WP_000148855.1.30047 WP_000148855.1.30057 WP_000148855.1.30150 WP_000148855.1.30176 WP_000148855.1.30186 WP_000148855.1.30188 WP_000148855.1.30190 WP_000148855.1.30262 WP_000148855.1.30274 WP_000148855.1.3029 WP_000148855.1.30294 WP_000148855.1.30333 WP_000148855.1.30367 WP_000148855.1.30376 WP_000148855.1.30418 WP_000148855.1.30422 WP_000148855.1.30458 WP_000148855.1.30477 WP_000148855.1.30496 WP_000148855.1.30530 WP_000148855.1.30623 WP_000148855.1.30690 WP_000148855.1.30758 WP_000148855.1.30768 WP_000148855.1.30861 WP_000148855.1.30862 WP_000148855.1.30863 WP_000148855.1.30874 WP_000148855.1.30878 WP_000148855.1.30889 WP_000148855.1.30916 WP_000148855.1.30945 WP_000148855.1.3097 WP_000148855.1.30970 WP_000148855.1.30971 WP_000148855.1.31037 WP_000148855.1.31114 WP_000148855.1.31120 WP_000148855.1.31124 WP_000148855.1.31194 WP_000148855.1.31202 WP_000148855.1.31212 WP_000148855.1.31232 WP_000148855.1.31363 WP_000148855.1.31376 WP_000148855.1.31426 WP_000148855.1.31436 WP_000148855.1.31478 WP_000148855.1.315 WP_000148855.1.31505 WP_000148855.1.31567 WP_000148855.1.31611 WP_000148855.1.31638 WP_000148855.1.31667 WP_000148855.1.31701 WP_000148855.1.31787 WP_000148855.1.31791 WP_000148855.1.31797 WP_000148855.1.31816 WP_000148855.1.31817 WP_000148855.1.31897 WP_000148855.1.31925 WP_000148855.1.31943 WP_000148855.1.31994 WP_000148855.1.32040 WP_000148855.1.32059 WP_000148855.1.32095 WP_000148855.1.32106 WP_000148855.1.32118 WP_000148855.1.32122 WP_000148855.1.32125 WP_000148855.1.32130 WP_000148855.1.32167 WP_000148855.1.32217 WP_000148855.1.32244 WP_000148855.1.32248 WP_000148855.1.32269 WP_000148855.1.32281 WP_000148855.1.32295 WP_000148855.1.32301 WP_000148855.1.32348 WP_000148855.1.32384 WP_000148855.1.32405 WP_000148855.1.3244 WP_000148855.1.32464 WP_000148855.1.32497 WP_000148855.1.32546 WP_000148855.1.32739 WP_000148855.1.32839 WP_000148855.1.32898 WP_000148855.1.32921 WP_000148855.1.3293 WP_000148855.1.32965 WP_000148855.1.32987 WP_000148855.1.3299 WP_000148855.1.3306 WP_000148855.1.33108 WP_000148855.1.33147 WP_000148855.1.3316 WP_000148855.1.33213 WP_000148855.1.33252 WP_000148855.1.33255 WP_000148855.1.33277 WP_000148855.1.33292 WP_000148855.1.33307 WP_000148855.1.3335 WP_000148855.1.33350 WP_000148855.1.3338 WP_000148855.1.33388 WP_000148855.1.3345 WP_000148855.1.33463 WP_000148855.1.33483 WP_000148855.1.33484 WP_000148855.1.33520 WP_000148855.1.33575 WP_000148855.1.3358 WP_000148855.1.33610 WP_000148855.1.33640 WP_000148855.1.33650 WP_000148855.1.33724 WP_000148855.1.33756 WP_000148855.1.33765 WP_000148855.1.33778 WP_000148855.1.33816 WP_000148855.1.33899 WP_000148855.1.33963 WP_000148855.1.33994 WP_000148855.1.34069 WP_000148855.1.34089 WP_000148855.1.34105 WP_000148855.1.34112 WP_000148855.1.34172 WP_000148855.1.3418 WP_000148855.1.34194 WP_000148855.1.34223 WP_000148855.1.34280 WP_000148855.1.34307 WP_000148855.1.34334 WP_000148855.1.34361 WP_000148855.1.34371 WP_000148855.1.3442 WP_000148855.1.34438 WP_000148855.1.34471 WP_000148855.1.3448 WP_000148855.1.34512 WP_000148855.1.34569 WP_000148855.1.34578 WP_000148855.1.34620 WP_000148855.1.34716 WP_000148855.1.34723 WP_000148855.1.3474 WP_000148855.1.34741 WP_000148855.1.34865 WP_000148855.1.34877 WP_000148855.1.34926 WP_000148855.1.34967 WP_000148855.1.35014 WP_000148855.1.35029 WP_000148855.1.35031 WP_000148855.1.35032 WP_000148855.1.35183 WP_000148855.1.35243 WP_000148855.1.3526 WP_000148855.1.35264 WP_000148855.1.35289 WP_000148855.1.35314 WP_000148855.1.35340 WP_000148855.1.35345 WP_000148855.1.35391 WP_000148855.1.35413 WP_000148855.1.35433 WP_000148855.1.35508 WP_000148855.1.35517 WP_000148855.1.35519 WP_000148855.1.35549 WP_000148855.1.35642 WP_000148855.1.35659 WP_000148855.1.35661 WP_000148855.1.35686 WP_000148855.1.35696 WP_000148855.1.35746 WP_000148855.1.35784 WP_000148855.1.3579 WP_000148855.1.35890 WP_000148855.1.35903 WP_000148855.1.35933 WP_000148855.1.36093 WP_000148855.1.36179 WP_000148855.1.36208 WP_000148855.1.36211 WP_000148855.1.36223 WP_000148855.1.36231 WP_000148855.1.36249 WP_000148855.1.36302 WP_000148855.1.36430 WP_000148855.1.36434 WP_000148855.1.36439 WP_000148855.1.36640 WP_000148855.1.36669 WP_000148855.1.36729 WP_000148855.1.36773 WP_000148855.1.36793 WP_000148855.1.36820 WP_000148855.1.36823 WP_000148855.1.36888 WP_000148855.1.36903 WP_000148855.1.36911 WP_000148855.1.36932 WP_000148855.1.36952 WP_000148855.1.36983 WP_000148855.1.37053 WP_000148855.1.3709 WP_000148855.1.37120 WP_000148855.1.37130 WP_000148855.1.37135 WP_000148855.1.37145 WP_000148855.1.37159 WP_000148855.1.3722 WP_000148855.1.37240 WP_000148855.1.37335 WP_000148855.1.37336 WP_000148855.1.37343 WP_000148855.1.37378 WP_000148855.1.37411 WP_000148855.1.37435 WP_000148855.1.37525 WP_000148855.1.37578 WP_000148855.1.37644 WP_000148855.1.37669 WP_000148855.1.37679 WP_000148855.1.3774 WP_000148855.1.37749 WP_000148855.1.37764 WP_000148855.1.37771 WP_000148855.1.37788 WP_000148855.1.37851 WP_000148855.1.37878 WP_000148855.1.37906 WP_000148855.1.37907 WP_000148855.1.37929 WP_000148855.1.38030 WP_000148855.1.38111 WP_000148855.1.38128 WP_000148855.1.38136 WP_000148855.1.38148 WP_000148855.1.38222 WP_000148855.1.38304 WP_000148855.1.38316 WP_000148855.1.38390 WP_000148855.1.38435 WP_000148855.1.38491 WP_000148855.1.38516 WP_000148855.1.38555 WP_000148855.1.38637 WP_000148855.1.38651 WP_000148855.1.38669 WP_000148855.1.38688 WP_000148855.1.3875 WP_000148855.1.38788 WP_000148855.1.38836 WP_000148855.1.38862 WP_000148855.1.38875 WP_000148855.1.38885 WP_000148855.1.38890 WP_000148855.1.38927 WP_000148855.1.38960 WP_000148855.1.38973 WP_000148855.1.39017 WP_000148855.1.39026 WP_000148855.1.39080 WP_000148855.1.39089 WP_000148855.1.39126 WP_000148855.1.39166 WP_000148855.1.39324 WP_000148855.1.39347 WP_000148855.1.39361 WP_000148855.1.39432 WP_000148855.1.39499 WP_000148855.1.39527 WP_000148855.1.39542 WP_000148855.1.39670 WP_000148855.1.39671 WP_000148855.1.39682 WP_000148855.1.39693 WP_000148855.1.39839 WP_000148855.1.39847 WP_000148855.1.39857 WP_000148855.1.39883 WP_000148855.1.39943 WP_000148855.1.39995 WP_000148855.1.40076 WP_000148855.1.4010 WP_000148855.1.40119 WP_000148855.1.40247 WP_000148855.1.40299 WP_000148855.1.40329 WP_000148855.1.40369 WP_000148855.1.40409 WP_000148855.1.40428 WP_000148855.1.40443 WP_000148855.1.40454 WP_000148855.1.40458 WP_000148855.1.40463 WP_000148855.1.40483 WP_000148855.1.40500 WP_000148855.1.40613 WP_000148855.1.40670 WP_000148855.1.40700 WP_000148855.1.40729 WP_000148855.1.4078 WP_000148855.1.40780 WP_000148855.1.40794 WP_000148855.1.40814 WP_000148855.1.40939 WP_000148855.1.40997 WP_000148855.1.41002 WP_000148855.1.41033 WP_000148855.1.41038 WP_000148855.1.4105 WP_000148855.1.41066 WP_000148855.1.412 WP_000148855.1.41341 WP_000148855.1.41350 WP_000148855.1.41374 WP_000148855.1.41389 WP_000148855.1.41411 WP_000148855.1.41448 WP_000148855.1.41537 WP_000148855.1.41581 WP_000148855.1.41587 WP_000148855.1.41597 WP_000148855.1.41598 WP_000148855.1.41612 WP_000148855.1.41620 WP_000148855.1.41681 WP_000148855.1.4169 WP_000148855.1.41698 WP_000148855.1.41726 WP_000148855.1.41743 WP_000148855.1.41755 WP_000148855.1.41770 WP_000148855.1.41796 WP_000148855.1.4182 WP_000148855.1.41821 WP_000148855.1.41863 WP_000148855.1.41954 WP_000148855.1.41972 WP_000148855.1.42003 WP_000148855.1.42056 WP_000148855.1.42072 WP_000148855.1.42169 WP_000148855.1.42178 WP_000148855.1.42241 WP_000148855.1.4225 WP_000148855.1.42286 WP_000148855.1.42298 WP_000148855.1.42325 WP_000148855.1.42607 WP_000148855.1.42667 WP_000148855.1.42681 WP_000148855.1.42733 WP_000148855.1.42764 WP_000148855.1.42816 WP_000148855.1.42883 WP_000148855.1.42907 WP_000148855.1.42924 WP_000148855.1.42925 WP_000148855.1.42959 WP_000148855.1.42984 WP_000148855.1.42985 WP_000148855.1.42990 WP_000148855.1.4300 WP_000148855.1.43023 WP_000148855.1.43061 WP_000148855.1.43095 WP_000148855.1.43110 WP_000148855.1.43125 WP_000148855.1.43139 WP_000148855.1.43168 WP_000148855.1.43179 WP_000148855.1.43204 WP_000148855.1.43220 WP_000148855.1.43252 WP_000148855.1.43279 WP_000148855.1.43331 WP_000148855.1.43360 WP_000148855.1.43375 WP_000148855.1.43383 WP_000148855.1.43405 WP_000148855.1.43414 WP_000148855.1.43446 WP_000148855.1.43512 WP_000148855.1.43530 WP_000148855.1.43573 WP_000148855.1.43594 WP_000148855.1.43665 WP_000148855.1.43683 WP_000148855.1.4369 WP_000148855.1.43693 WP_000148855.1.43784 WP_000148855.1.4379 WP_000148855.1.43800 WP_000148855.1.43851 WP_000148855.1.4386 WP_000148855.1.43964 WP_000148855.1.43995 WP_000148855.1.44021 WP_000148855.1.44074 WP_000148855.1.44150 WP_000148855.1.44177 WP_000148855.1.44255 WP_000148855.1.44344 WP_000148855.1.44382 WP_000148855.1.44432 WP_000148855.1.44480 WP_000148855.1.44504 WP_000148855.1.44515 WP_000148855.1.44520 WP_000148855.1.44547 WP_000148855.1.44586 WP_000148855.1.44623 WP_000148855.1.44646 WP_000148855.1.44667 WP_000148855.1.447 WP_000148855.1.44714 WP_000148855.1.44856 WP_000148855.1.44868 WP_000148855.1.44876 WP_000148855.1.44892 WP_000148855.1.44899 WP_000148855.1.44903 WP_000148855.1.44948 WP_000148855.1.44993 WP_000148855.1.45010 WP_000148855.1.45042 WP_000148855.1.45080 WP_000148855.1.45091 WP_000148855.1.45094 WP_000148855.1.45101 WP_000148855.1.45131 WP_000148855.1.45132 WP_000148855.1.45140 WP_000148855.1.45157 WP_000148855.1.45162 WP_000148855.1.452 WP_000148855.1.45218 WP_000148855.1.45223 WP_000148855.1.45242 WP_000148855.1.45267 WP_000148855.1.45281 WP_000148855.1.45303 WP_000148855.1.45450 WP_000148855.1.45456 WP_000148855.1.4546 WP_000148855.1.45492 WP_000148855.1.45542 WP_000148855.1.45555 WP_000148855.1.45574 WP_000148855.1.45610 WP_000148855.1.45620 WP_000148855.1.45645 WP_000148855.1.45705 WP_000148855.1.45763 WP_000148855.1.4577 WP_000148855.1.45773 WP_000148855.1.4582 WP_000148855.1.45822 WP_000148855.1.45859 WP_000148855.1.45862 WP_000148855.1.45874 WP_000148855.1.45977 WP_000148855.1.45979 WP_000148855.1.46035 WP_000148855.1.46037 WP_000148855.1.46050 WP_000148855.1.46062 WP_000148855.1.46078 WP_000148855.1.46171 WP_000148855.1.46172 WP_000148855.1.46185 WP_000148855.1.46195 WP_000148855.1.46289 WP_000148855.1.46333 WP_000148855.1.46339 WP_000148855.1.46353 WP_000148855.1.46488 WP_000148855.1.46514 WP_000148855.1.46529 WP_000148855.1.46576 WP_000148855.1.46619 WP_000148855.1.46648 WP_000148855.1.46676 WP_000148855.1.46696 WP_000148855.1.46720 WP_000148855.1.46736 WP_000148855.1.46770 WP_000148855.1.4680 WP_000148855.1.46815 WP_000148855.1.46906 WP_000148855.1.46914 WP_000148855.1.46929 WP_000148855.1.4694 WP_000148855.1.46947 WP_000148855.1.47002 WP_000148855.1.47090 WP_000148855.1.47107 WP_000148855.1.47111 WP_000148855.1.47250 WP_000148855.1.47282 WP_000148855.1.47308 WP_000148855.1.47331 WP_000148855.1.47334 WP_000148855.1.47353 WP_000148855.1.47408 WP_000148855.1.47459 WP_000148855.1.47493 WP_000148855.1.47522 WP_000148855.1.47530 WP_000148855.1.47541 WP_000148855.1.47554 WP_000148855.1.47561 WP_000148855.1.47617 WP_000148855.1.47629 WP_000148855.1.47667 WP_000148855.1.47669 WP_000148855.1.47680 WP_000148855.1.47747 WP_000148855.1.47851 WP_000148855.1.47888 WP_000148855.1.47908 WP_000148855.1.4792 WP_000148855.1.48013 WP_000148855.1.48046 WP_000148855.1.48057 WP_000148855.1.48067 WP_000148855.1.48116 WP_000148855.1.48142 WP_000148855.1.48156 WP_000148855.1.48187 WP_000148855.1.48199 WP_000148855.1.48212 WP_000148855.1.48223 WP_000148855.1.48272 WP_000148855.1.48282 WP_000148855.1.48310 WP_000148855.1.48335 WP_000148855.1.48376 WP_000148855.1.48398 WP_000148855.1.4840 WP_000148855.1.48427 WP_000148855.1.48437 WP_000148855.1.48438 WP_000148855.1.48479 WP_000148855.1.4852 WP_000148855.1.48556 WP_000148855.1.48580 WP_000148855.1.48601 WP_000148855.1.48670 WP_000148855.1.48723 WP_000148855.1.48769 WP_000148855.1.48782 WP_000148855.1.48869 WP_000148855.1.48943 WP_000148855.1.48996 WP_000148855.1.49018 WP_000148855.1.49071 WP_000148855.1.49094 WP_000148855.1.49105 WP_000148855.1.49171 WP_000148855.1.49189 WP_000148855.1.49196 WP_000148855.1.49199 WP_000148855.1.4920 WP_000148855.1.49227 WP_000148855.1.49301 WP_000148855.1.49326 WP_000148855.1.49367 WP_000148855.1.49373 WP_000148855.1.49418 WP_000148855.1.4945 WP_000148855.1.49518 WP_000148855.1.49549 WP_000148855.1.49581 WP_000148855.1.49582 WP_000148855.1.496 WP_000148855.1.49603 WP_000148855.1.49643 WP_000148855.1.49672 WP_000148855.1.49690 WP_000148855.1.49728 WP_000148855.1.49732 WP_000148855.1.49745 WP_000148855.1.49819 WP_000148855.1.49825 WP_000148855.1.49912 WP_000148855.1.49918 WP_000148855.1.49921 WP_000148855.1.49935 WP_000148855.1.50028 WP_000148855.1.50071 WP_000148855.1.50117 WP_000148855.1.50145 WP_000148855.1.50192 WP_000148855.1.50291 WP_000148855.1.50367 WP_000148855.1.50388 WP_000148855.1.5045 WP_000148855.1.50464 WP_000148855.1.50525 WP_000148855.1.50558 WP_000148855.1.50568 WP_000148855.1.5059 WP_000148855.1.50594 WP_000148855.1.50647 WP_000148855.1.50699 WP_000148855.1.50711 WP_000148855.1.50740 WP_000148855.1.50745 WP_000148855.1.5080 WP_000148855.1.50817 WP_000148855.1.50829 WP_000148855.1.50974 WP_000148855.1.51015 WP_000148855.1.51031 WP_000148855.1.5108 WP_000148855.1.51130 WP_000148855.1.51209 WP_000148855.1.51220 WP_000148855.1.51226 WP_000148855.1.51277 WP_000148855.1.51326 WP_000148855.1.51365 WP_000148855.1.51465 WP_000148855.1.51496 WP_000148855.1.51557 WP_000148855.1.51558 WP_000148855.1.51571 WP_000148855.1.51672 WP_000148855.1.51794 WP_000148855.1.51824 WP_000148855.1.5186 WP_000148855.1.51973 WP_000148855.1.52034 WP_000148855.1.52061 WP_000148855.1.52072 WP_000148855.1.5209 WP_000148855.1.52195 WP_000148855.1.52198 WP_000148855.1.52210 WP_000148855.1.5228 WP_000148855.1.52289 WP_000148855.1.52308 WP_000148855.1.52343 WP_000148855.1.52377 WP_000148855.1.52423 WP_000148855.1.52427 WP_000148855.1.52436 WP_000148855.1.52452 WP_000148855.1.5251 WP_000148855.1.52511 WP_000148855.1.52605 WP_000148855.1.52754 WP_000148855.1.52830 WP_000148855.1.52836 WP_000148855.1.52886 WP_000148855.1.52889 WP_000148855.1.52893 WP_000148855.1.52900 WP_000148855.1.52965 WP_000148855.1.52983 WP_000148855.1.5304 WP_000148855.1.53050 WP_000148855.1.53057 WP_000148855.1.53189 WP_000148855.1.5319 WP_000148855.1.5321 WP_000148855.1.5323 WP_000148855.1.53245 WP_000148855.1.53285 WP_000148855.1.53312 WP_000148855.1.53323 WP_000148855.1.53352 WP_000148855.1.53363 WP_000148855.1.53372 WP_000148855.1.53373 WP_000148855.1.53379 WP_000148855.1.53408 WP_000148855.1.53418 WP_000148855.1.53452 WP_000148855.1.53467 WP_000148855.1.53488 WP_000148855.1.53503 WP_000148855.1.5359 WP_000148855.1.53774 WP_000148855.1.53799 WP_000148855.1.53886 WP_000148855.1.53926 WP_000148855.1.54029 WP_000148855.1.54048 WP_000148855.1.54049 WP_000148855.1.54074 WP_000148855.1.54086 WP_000148855.1.54105 WP_000148855.1.54161 WP_000148855.1.54237 WP_000148855.1.54246 WP_000148855.1.54373 WP_000148855.1.54404 WP_000148855.1.54438 WP_000148855.1.54446 WP_000148855.1.54471 WP_000148855.1.54479 WP_000148855.1.54485 WP_000148855.1.54554 WP_000148855.1.54574 WP_000148855.1.54689 WP_000148855.1.54744 WP_000148855.1.54895 WP_000148855.1.54931 WP_000148855.1.54967 WP_000148855.1.54990 WP_000148855.1.5500 WP_000148855.1.55004 WP_000148855.1.55082 WP_000148855.1.55084 WP_000148855.1.55095 WP_000148855.1.5518 WP_000148855.1.552 WP_000148855.1.55239 WP_000148855.1.55271 WP_000148855.1.55327 WP_000148855.1.55336 WP_000148855.1.5536 WP_000148855.1.55419 WP_000148855.1.55495 WP_000148855.1.5550 WP_000148855.1.55527 WP_000148855.1.55535 WP_000148855.1.55603 WP_000148855.1.55657 WP_000148855.1.55717 WP_000148855.1.55719 WP_000148855.1.55724 WP_000148855.1.55845 WP_000148855.1.55949 WP_000148855.1.55955 WP_000148855.1.55960 WP_000148855.1.55991 WP_000148855.1.56003 WP_000148855.1.5604 WP_000148855.1.5606 WP_000148855.1.56064 WP_000148855.1.56106 WP_000148855.1.56135 WP_000148855.1.56200 WP_000148855.1.56220 WP_000148855.1.56237 WP_000148855.1.56306 WP_000148855.1.56387 WP_000148855.1.56444 WP_000148855.1.56482 WP_000148855.1.56527 WP_000148855.1.56530 WP_000148855.1.56542 WP_000148855.1.56608 WP_000148855.1.56619 WP_000148855.1.56696 WP_000148855.1.56702 WP_000148855.1.56708 WP_000148855.1.56722 WP_000148855.1.5675 WP_000148855.1.56772 WP_000148855.1.56803 WP_000148855.1.56822 WP_000148855.1.56903 WP_000148855.1.56931 WP_000148855.1.56966 WP_000148855.1.56967 WP_000148855.1.56975 WP_000148855.1.57015 WP_000148855.1.57024 WP_000148855.1.5705 WP_000148855.1.57080 WP_000148855.1.57081 WP_000148855.1.57102 WP_000148855.1.57115 WP_000148855.1.57141 WP_000148855.1.57196 WP_000148855.1.57330 WP_000148855.1.57389 WP_000148855.1.57448 WP_000148855.1.57459 WP_000148855.1.5749 WP_000148855.1.57577 WP_000148855.1.57593 WP_000148855.1.57614 WP_000148855.1.57670 WP_000148855.1.57693 WP_000148855.1.57701 WP_000148855.1.57718 WP_000148855.1.57723 WP_000148855.1.57745 WP_000148855.1.57783 WP_000148855.1.57844 WP_000148855.1.57875 WP_000148855.1.57883 WP_000148855.1.57962 WP_000148855.1.5799 WP_000148855.1.58006 WP_000148855.1.58042 WP_000148855.1.58051 WP_000148855.1.58106 WP_000148855.1.58122 WP_000148855.1.5817 WP_000148855.1.58198 WP_000148855.1.58241 WP_000148855.1.58242 WP_000148855.1.58246 WP_000148855.1.5832 WP_000148855.1.58321 WP_000148855.1.58325 WP_000148855.1.58350 WP_000148855.1.58353 WP_000148855.1.58366 WP_000148855.1.58373 WP_000148855.1.58392 WP_000148855.1.58419 WP_000148855.1.58421 WP_000148855.1.5849 WP_000148855.1.58495 WP_000148855.1.58504 WP_000148855.1.58508 WP_000148855.1.58521 WP_000148855.1.58538 WP_000148855.1.586 WP_000148855.1.58626 WP_000148855.1.58714 WP_000148855.1.58718 WP_000148855.1.58775 WP_000148855.1.58839 WP_000148855.1.58936 WP_000148855.1.58998 WP_000148855.1.5904 WP_000148855.1.59046 WP_000148855.1.59062 WP_000148855.1.59133 WP_000148855.1.59157 WP_000148855.1.59175 WP_000148855.1.5925 WP_000148855.1.59269 WP_000148855.1.59284 WP_000148855.1.5930 WP_000148855.1.59327 WP_000148855.1.59363 WP_000148855.1.5938 WP_000148855.1.59380 WP_000148855.1.59397 WP_000148855.1.59457 WP_000148855.1.59459 WP_000148855.1.59467 WP_000148855.1.59478 WP_000148855.1.59547 WP_000148855.1.59567 WP_000148855.1.59603 WP_000148855.1.59629 WP_000148855.1.59663 WP_000148855.1.59697 WP_000148855.1.59736 WP_000148855.1.59803 WP_000148855.1.59810 WP_000148855.1.59881 WP_000148855.1.59886 WP_000148855.1.59921 WP_000148855.1.59945 WP_000148855.1.59977 WP_000148855.1.60022 WP_000148855.1.60086 WP_000148855.1.60101 WP_000148855.1.60156 WP_000148855.1.60165 WP_000148855.1.60181 WP_000148855.1.602 WP_000148855.1.60201 WP_000148855.1.60251 WP_000148855.1.60259 WP_000148855.1.60280 WP_000148855.1.60289 WP_000148855.1.60307 WP_000148855.1.60368 WP_000148855.1.6045 WP_000148855.1.60462 WP_000148855.1.60515 WP_000148855.1.60594 WP_000148855.1.60690 WP_000148855.1.60696 WP_000148855.1.60704 WP_000148855.1.60787 WP_000148855.1.60898 WP_000148855.1.60917 WP_000148855.1.60939 WP_000148855.1.60946 WP_000148855.1.60981 WP_000148855.1.60982 WP_000148855.1.61009 WP_000148855.1.61030 WP_000148855.1.61107 WP_000148855.1.61119 WP_000148855.1.61152 WP_000148855.1.61153 WP_000148855.1.6118 WP_000148855.1.61188 WP_000148855.1.61257 WP_000148855.1.61324 WP_000148855.1.61327 WP_000148855.1.61339 WP_000148855.1.61353 WP_000148855.1.61408 WP_000148855.1.61421 WP_000148855.1.61534 WP_000148855.1.61547 WP_000148855.1.61591 WP_000148855.1.6168 WP_000148855.1.61784 WP_000148855.1.61897 WP_000148855.1.61899 WP_000148855.1.61910 WP_000148855.1.61970 WP_000148855.1.62030 WP_000148855.1.6208 WP_000148855.1.62084 WP_000148855.1.62085 WP_000148855.1.62088 WP_000148855.1.62093 WP_000148855.1.62140 WP_000148855.1.62164 WP_000148855.1.62253 WP_000148855.1.6234 WP_000148855.1.62409 WP_000148855.1.62416 WP_000148855.1.62437 WP_000148855.1.62459 WP_000148855.1.62537 WP_000148855.1.62575 WP_000148855.1.62608 WP_000148855.1.62621 WP_000148855.1.62685 WP_000148855.1.62740 WP_000148855.1.62796 WP_000148855.1.62808 WP_000148855.1.62829 WP_000148855.1.62842 WP_000148855.1.62860 WP_000148855.1.62878 WP_000148855.1.62956 WP_000148855.1.63004 WP_000148855.1.63011 WP_000148855.1.63040 WP_000148855.1.63047 WP_000148855.1.63050 WP_000148855.1.63051 WP_000148855.1.63068 WP_000148855.1.631 WP_000148855.1.63120 WP_000148855.1.63131 WP_000148855.1.63132 WP_000148855.1.63143 WP_000148855.1.63170 WP_000148855.1.63182 WP_000148855.1.63190 WP_000148855.1.63195 WP_000148855.1.63215 WP_000148855.1.63228 WP_000148855.1.63244 WP_000148855.1.63273 WP_000148855.1.63279 WP_000148855.1.63296 WP_000148855.1.63307 WP_000148855.1.63319 WP_000148855.1.63324 WP_000148855.1.63335 WP_000148855.1.63337 WP_000148855.1.63406 WP_000148855.1.63411 WP_000148855.1.63421 WP_000148855.1.63460 WP_000148855.1.63527 WP_000148855.1.63565 WP_000148855.1.63617 WP_000148855.1.63635 WP_000148855.1.63693 WP_000148855.1.63705 WP_000148855.1.6378 WP_000148855.1.63847 WP_000148855.1.63894 WP_000148855.1.63910 WP_000148855.1.63923 WP_000148855.1.63975 WP_000148855.1.63978 WP_000148855.1.64012 WP_000148855.1.64094 WP_000148855.1.64105 WP_000148855.1.64108 WP_000148855.1.64127 WP_000148855.1.64207 WP_000148855.1.64234 WP_000148855.1.64251 WP_000148855.1.64288 WP_000148855.1.64303 WP_000148855.1.64368 WP_000148855.1.64396 WP_000148855.1.64400 WP_000148855.1.64549 WP_000148855.1.64665 WP_000148855.1.64811 WP_000148855.1.64845 WP_000148855.1.64860 WP_000148855.1.64951 WP_000148855.1.64988 WP_000148855.1.64994 WP_000148855.1.64996 WP_000148855.1.65025 WP_000148855.1.65038 WP_000148855.1.65046 WP_000148855.1.65076 WP_000148855.1.65233 WP_000148855.1.65346 WP_000148855.1.65387 WP_000148855.1.65406 WP_000148855.1.65407 WP_000148855.1.6544 WP_000148855.1.65448 WP_000148855.1.65512 WP_000148855.1.65585 WP_000148855.1.65600 WP_000148855.1.65616 WP_000148855.1.65629 WP_000148855.1.65643 WP_000148855.1.65656 WP_000148855.1.6568 WP_000148855.1.65713 WP_000148855.1.65717 WP_000148855.1.65734 WP_000148855.1.65769 WP_000148855.1.65809 WP_000148855.1.6585 WP_000148855.1.65870 WP_000148855.1.65879 WP_000148855.1.65886 WP_000148855.1.65892 WP_000148855.1.65930 WP_000148855.1.65935 WP_000148855.1.65946 WP_000148855.1.65947 WP_000148855.1.65965 WP_000148855.1.65986 WP_000148855.1.66054 WP_000148855.1.66069 WP_000148855.1.66073 WP_000148855.1.6612 WP_000148855.1.66130 WP_000148855.1.66144 WP_000148855.1.66265 WP_000148855.1.66287 WP_000148855.1.66298 WP_000148855.1.6632 WP_000148855.1.66322 WP_000148855.1.66366 WP_000148855.1.66453 WP_000148855.1.66482 WP_000148855.1.66513 WP_000148855.1.66556 WP_000148855.1.66598 WP_000148855.1.66611 WP_000148855.1.66614 WP_000148855.1.66628 WP_000148855.1.66705 WP_000148855.1.66756 WP_000148855.1.66765 WP_000148855.1.66766 WP_000148855.1.66803 WP_000148855.1.66816 WP_000148855.1.6688 WP_000148855.1.66938 WP_000148855.1.66969 WP_000148855.1.66996 WP_000148855.1.6700 WP_000148855.1.67012 WP_000148855.1.67014 WP_000148855.1.67063 WP_000148855.1.67067 WP_000148855.1.67072 WP_000148855.1.67147 WP_000148855.1.67155 WP_000148855.1.67160 WP_000148855.1.67212 WP_000148855.1.67238 WP_000148855.1.67251 WP_000148855.1.67259 WP_000148855.1.6726 WP_000148855.1.67294 WP_000148855.1.67328 WP_000148855.1.67418 WP_000148855.1.67420 WP_000148855.1.67425 WP_000148855.1.67457 WP_000148855.1.67460 WP_000148855.1.67540 WP_000148855.1.67571 WP_000148855.1.67621 WP_000148855.1.67644 WP_000148855.1.67653 WP_000148855.1.67691 WP_000148855.1.67762 WP_000148855.1.67806 WP_000148855.1.67834 WP_000148855.1.67864 WP_000148855.1.67867 WP_000148855.1.67880 WP_000148855.1.67900 WP_000148855.1.67991 WP_000148855.1.68101 WP_000148855.1.68134 WP_000148855.1.68141 WP_000148855.1.68152 WP_000148855.1.68202 WP_000148855.1.68221 WP_000148855.1.68223 WP_000148855.1.6824 WP_000148855.1.68268 WP_000148855.1.68299 WP_000148855.1.68355 WP_000148855.1.68366 WP_000148855.1.68399 WP_000148855.1.68466 WP_000148855.1.68476 WP_000148855.1.68479 WP_000148855.1.68504 WP_000148855.1.68505 WP_000148855.1.68548 WP_000148855.1.686 WP_000148855.1.68657 WP_000148855.1.68681 WP_000148855.1.68683 WP_000148855.1.68716 WP_000148855.1.68741 WP_000148855.1.68743 WP_000148855.1.68878 WP_000148855.1.68883 WP_000148855.1.68987 WP_000148855.1.68988 WP_000148855.1.68998 WP_000148855.1.69012 WP_000148855.1.69071 WP_000148855.1.69078 WP_000148855.1.69120 WP_000148855.1.6915 WP_000148855.1.69179 WP_000148855.1.69198 WP_000148855.1.69213 WP_000148855.1.69232 WP_000148855.1.69251 WP_000148855.1.69266 WP_000148855.1.69349 WP_000148855.1.69361 WP_000148855.1.69394 WP_000148855.1.69409 WP_000148855.1.69437 WP_000148855.1.69546 WP_000148855.1.69598 WP_000148855.1.6968 WP_000148855.1.69683 WP_000148855.1.69724 WP_000148855.1.6980 WP_000148855.1.69820 WP_000148855.1.69823 WP_000148855.1.69830 WP_000148855.1.69842 WP_000148855.1.69882 WP_000148855.1.699 WP_000148855.1.69902 WP_000148855.1.69934 WP_000148855.1.69980 WP_000148855.1.70094 WP_000148855.1.70161 WP_000148855.1.70220 WP_000148855.1.70225 WP_000148855.1.70228 WP_000148855.1.70294 WP_000148855.1.70311 WP_000148855.1.70313 WP_000148855.1.70334 WP_000148855.1.70413 WP_000148855.1.70441 WP_000148855.1.70448 WP_000148855.1.70487 WP_000148855.1.70527 WP_000148855.1.70554 WP_000148855.1.70558 WP_000148855.1.706 WP_000148855.1.70611 WP_000148855.1.7064 WP_000148855.1.707 WP_000148855.1.70721 WP_000148855.1.70763 WP_000148855.1.70807 WP_000148855.1.70808 WP_000148855.1.70829 WP_000148855.1.70835 WP_000148855.1.70843 WP_000148855.1.70909 WP_000148855.1.70926 WP_000148855.1.710 WP_000148855.1.71016 WP_000148855.1.7105 WP_000148855.1.71143 WP_000148855.1.7119 WP_000148855.1.71208 WP_000148855.1.71231 WP_000148855.1.71236 WP_000148855.1.71267 WP_000148855.1.71313 WP_000148855.1.71316 WP_000148855.1.71410 WP_000148855.1.71466 WP_000148855.1.71467 WP_000148855.1.71590 WP_000148855.1.7164 WP_000148855.1.71707 WP_000148855.1.71715 WP_000148855.1.71737 WP_000148855.1.71739 WP_000148855.1.71741 WP_000148855.1.71877 WP_000148855.1.71892 WP_000148855.1.71910 WP_000148855.1.7193 WP_000148855.1.71978 WP_000148855.1.72002 WP_000148855.1.72018 WP_000148855.1.72085 WP_000148855.1.72102 WP_000148855.1.72148 WP_000148855.1.72224 WP_000148855.1.72285 WP_000148855.1.72306 WP_000148855.1.72315 WP_000148855.1.72363 WP_000148855.1.72371 WP_000148855.1.72446 WP_000148855.1.72465 WP_000148855.1.72496 WP_000148855.1.72564 WP_000148855.1.7258 WP_000148855.1.7260 WP_000148855.1.72649 WP_000148855.1.72708 WP_000148855.1.72719 WP_000148855.1.72753 WP_000148855.1.72762 WP_000148855.1.72881 WP_000148855.1.72961 WP_000148855.1.72991 WP_000148855.1.73021 WP_000148855.1.73046 WP_000148855.1.73087 WP_000148855.1.73121 WP_000148855.1.73140 WP_000148855.1.73190 WP_000148855.1.73191 WP_000148855.1.73195 WP_000148855.1.73201 WP_000148855.1.73211 WP_000148855.1.73240 WP_000148855.1.73241 WP_000148855.1.7326 WP_000148855.1.73264 WP_000148855.1.73401 WP_000148855.1.73402 WP_000148855.1.73420 WP_000148855.1.73444 WP_000148855.1.73450 WP_000148855.1.73464 WP_000148855.1.73513 WP_000148855.1.73539 WP_000148855.1.73610 WP_000148855.1.73640 WP_000148855.1.7365 WP_000148855.1.73674 WP_000148855.1.73693 WP_000148855.1.73694 WP_000148855.1.73740 WP_000148855.1.73789 WP_000148855.1.73853 WP_000148855.1.73885 WP_000148855.1.73900 WP_000148855.1.73902 WP_000148855.1.73921 WP_000148855.1.73940 WP_000148855.1.73949 WP_000148855.1.73971 WP_000148855.1.74004 WP_000148855.1.7401 WP_000148855.1.7406 WP_000148855.1.74073 WP_000148855.1.74085 WP_000148855.1.74138 WP_000148855.1.74155 WP_000148855.1.74221 WP_000148855.1.74242 WP_000148855.1.74257 WP_000148855.1.74273 WP_000148855.1.74284 WP_000148855.1.74295 WP_000148855.1.74327 WP_000148855.1.74390 WP_000148855.1.74456 WP_000148855.1.74468 WP_000148855.1.74474 WP_000148855.1.74497 WP_000148855.1.74510 WP_000148855.1.74576 WP_000148855.1.74590 WP_000148855.1.74645 WP_000148855.1.74676 WP_000148855.1.74681 WP_000148855.1.74693 WP_000148855.1.74758 WP_000148855.1.74761 WP_000148855.1.74770 WP_000148855.1.74775 WP_000148855.1.74785 WP_000148855.1.74797 WP_000148855.1.74808 WP_000148855.1.7482 WP_000148855.1.74846 WP_000148855.1.74874 WP_000148855.1.74978 WP_000148855.1.75070 WP_000148855.1.75111 WP_000148855.1.75131 WP_000148855.1.75132 WP_000148855.1.75304 WP_000148855.1.75323 WP_000148855.1.75351 WP_000148855.1.75356 WP_000148855.1.75375 WP_000148855.1.75379 WP_000148855.1.75538 WP_000148855.1.75566 WP_000148855.1.75571 WP_000148855.1.75647 WP_000148855.1.75692 WP_000148855.1.75728 WP_000148855.1.75743 WP_000148855.1.75809 WP_000148855.1.75840 WP_000148855.1.75862 WP_000148855.1.75910 WP_000148855.1.76013 WP_000148855.1.7602 WP_000148855.1.76047 WP_000148855.1.76049 WP_000148855.1.76050 WP_000148855.1.76053 WP_000148855.1.7607 WP_000148855.1.76114 WP_000148855.1.76121 WP_000148855.1.76149 WP_000148855.1.76153 WP_000148855.1.76179 WP_000148855.1.76294 WP_000148855.1.76295 WP_000148855.1.76313 WP_000148855.1.76424 WP_000148855.1.76426 WP_000148855.1.76431 WP_000148855.1.76463 WP_000148855.1.76482 WP_000148855.1.76497 WP_000148855.1.76528 WP_000148855.1.76711 WP_000148855.1.76718 WP_000148855.1.76798 WP_000148855.1.76803 WP_000148855.1.76825 WP_000148855.1.76829 WP_000148855.1.76872 WP_000148855.1.76876 WP_000148855.1.76878 WP_000148855.1.76920 WP_000148855.1.76937 WP_000148855.1.7694 WP_000148855.1.77020 WP_000148855.1.77043 WP_000148855.1.77069 WP_000148855.1.77072 WP_000148855.1.77137 WP_000148855.1.77183 WP_000148855.1.77203 WP_000148855.1.77229 WP_000148855.1.77256 WP_000148855.1.77297 WP_000148855.1.77298 WP_000148855.1.77315 WP_000148855.1.77346 WP_000148855.1.77359 WP_000148855.1.77388 WP_000148855.1.77416 WP_000148855.1.77485 WP_000148855.1.77498 WP_000148855.1.77532 WP_000148855.1.77650 WP_000148855.1.77733 WP_000148855.1.77735 WP_000148855.1.77763 WP_000148855.1.77791 WP_000148855.1.77814 WP_000148855.1.7785 WP_000148855.1.7786 WP_000148855.1.77882 WP_000148855.1.77915 WP_000148855.1.77922 WP_000148855.1.77930 WP_000148855.1.77986 WP_000148855.1.78038 WP_000148855.1.78067 WP_000148855.1.78082 WP_000148855.1.78116 WP_000148855.1.78164 WP_000148855.1.78179 WP_000148855.1.78194 WP_000148855.1.78210 WP_000148855.1.78304 WP_000148855.1.7833 WP_000148855.1.78330 WP_000148855.1.78371 WP_000148855.1.78392 WP_000148855.1.78434 WP_000148855.1.78436 WP_000148855.1.78470 WP_000148855.1.78478 WP_000148855.1.78489 WP_000148855.1.78494 WP_000148855.1.7853 WP_000148855.1.78585 WP_000148855.1.78592 WP_000148855.1.78598 WP_000148855.1.7868 WP_000148855.1.78708 WP_000148855.1.78736 WP_000148855.1.78763 WP_000148855.1.78785 WP_000148855.1.78816 WP_000148855.1.78920 WP_000148855.1.78937 WP_000148855.1.78995 WP_000148855.1.7905 WP_000148855.1.79132 WP_000148855.1.7914 WP_000148855.1.79143 WP_000148855.1.79178 WP_000148855.1.79192 WP_000148855.1.79270 WP_000148855.1.79275 WP_000148855.1.79285 WP_000148855.1.7930 WP_000148855.1.7934 WP_000148855.1.79341 WP_000148855.1.79378 WP_000148855.1.79402 WP_000148855.1.79407 WP_000148855.1.79552 WP_000148855.1.79554 WP_000148855.1.79566 WP_000148855.1.79627 WP_000148855.1.79638 WP_000148855.1.79664 WP_000148855.1.79677 WP_000148855.1.79731 WP_000148855.1.79763 WP_000148855.1.7981 WP_000148855.1.79815 WP_000148855.1.79855 WP_000148855.1.79904 WP_000148855.1.79949 WP_000148855.1.80009 WP_000148855.1.80013 WP_000148855.1.80029 WP_000148855.1.80086 WP_000148855.1.80119 WP_000148855.1.80120 WP_000148855.1.80122 WP_000148855.1.80124 WP_000148855.1.80146 WP_000148855.1.80178 WP_000148855.1.80184 WP_000148855.1.80193 WP_000148855.1.80244 WP_000148855.1.80274 WP_000148855.1.80297 WP_000148855.1.80308 WP_000148855.1.80316 WP_000148855.1.80345 WP_000148855.1.80389 WP_000148855.1.8040 WP_000148855.1.80407 WP_000148855.1.80414 WP_000148855.1.80430 WP_000148855.1.80434 WP_000148855.1.8045 WP_000148855.1.80521 WP_000148855.1.80582 WP_000148855.1.80680 WP_000148855.1.80734 WP_000148855.1.80745 WP_000148855.1.80899 WP_000148855.1.809 WP_000148855.1.81010 WP_000148855.1.81049 WP_000148855.1.81052 WP_000148855.1.81055 WP_000148855.1.81132 WP_000148855.1.81151 WP_000148855.1.81172 WP_000148855.1.81176 WP_000148855.1.81184 WP_000148855.1.81214 WP_000148855.1.81228 WP_000148855.1.81288 WP_000148855.1.81508 WP_000148855.1.81522 WP_000148855.1.81574 WP_000148855.1.8160 WP_000148855.1.81604 WP_000148855.1.81619 WP_000148855.1.81645 WP_000148855.1.81651 WP_000148855.1.8180 WP_000148855.1.81838 WP_000148855.1.81847 WP_000148855.1.8185 WP_000148855.1.81969 WP_000148855.1.81990 WP_000148855.1.82026 WP_000148855.1.82058 WP_000148855.1.8206 WP_000148855.1.82091 WP_000148855.1.82100 WP_000148855.1.82103 WP_000148855.1.8213 WP_000148855.1.82174 WP_000148855.1.82184 WP_000148855.1.82253 WP_000148855.1.82281 WP_000148855.1.82301 WP_000148855.1.82321 WP_000148855.1.82349 WP_000148855.1.82406 WP_000148855.1.82458 WP_000148855.1.82468 WP_000148855.1.82472 WP_000148855.1.82525 WP_000148855.1.82558 WP_000148855.1.8266 WP_000148855.1.82665 WP_000148855.1.82678 WP_000148855.1.82768 WP_000148855.1.82824 WP_000148855.1.82855 WP_000148855.1.82941 WP_000148855.1.82999 WP_000148855.1.83046 WP_000148855.1.83054 WP_000148855.1.83066 WP_000148855.1.83078 WP_000148855.1.83088 WP_000148855.1.83103 WP_000148855.1.8318 WP_000148855.1.83203 WP_000148855.1.83291 WP_000148855.1.83314 WP_000148855.1.83359 WP_000148855.1.83405 WP_000148855.1.83417 WP_000148855.1.8346 WP_000148855.1.83467 WP_000148855.1.83472 WP_000148855.1.83479 WP_000148855.1.83520 WP_000148855.1.83541 WP_000148855.1.83553 WP_000148855.1.83624 WP_000148855.1.8366 WP_000148855.1.83674 WP_000148855.1.83728 WP_000148855.1.83756 WP_000148855.1.83758 WP_000148855.1.83788 WP_000148855.1.83797 WP_000148855.1.83844 WP_000148855.1.83868 WP_000148855.1.83886 WP_000148855.1.83980 WP_000148855.1.83989 WP_000148855.1.84010 WP_000148855.1.84025 WP_000148855.1.84054 WP_000148855.1.84118 WP_000148855.1.84161 WP_000148855.1.84188 WP_000148855.1.84414 WP_000148855.1.84415 WP_000148855.1.84418 WP_000148855.1.84590 WP_000148855.1.84596 WP_000148855.1.84608 WP_000148855.1.8462 WP_000148855.1.84648 WP_000148855.1.84696 WP_000148855.1.84700 WP_000148855.1.84770 WP_000148855.1.84826 WP_000148855.1.84844 WP_000148855.1.84847 WP_000148855.1.84854 WP_000148855.1.84924 WP_000148855.1.84943 WP_000148855.1.8496 WP_000148855.1.84975 WP_000148855.1.84978 WP_000148855.1.85017 WP_000148855.1.85026 WP_000148855.1.85045 WP_000148855.1.85070 WP_000148855.1.85113 WP_000148855.1.85160 WP_000148855.1.85173 WP_000148855.1.85229 WP_000148855.1.85289 WP_000148855.1.85292 WP_000148855.1.85374 WP_000148855.1.85375 WP_000148855.1.85376 WP_000148855.1.85409 WP_000148855.1.85440 WP_000148855.1.85441 WP_000148855.1.85485 WP_000148855.1.8551 WP_000148855.1.85611 WP_000148855.1.8572 WP_000148855.1.85730 WP_000148855.1.85732 WP_000148855.1.85825 WP_000148855.1.85858 WP_000148855.1.85906 WP_000148855.1.85924 WP_000148855.1.85971 WP_000148855.1.85980 WP_000148855.1.86036 WP_000148855.1.86042 WP_000148855.1.86086 WP_000148855.1.8609 WP_000148855.1.86209 WP_000148855.1.86241 WP_000148855.1.86281 WP_000148855.1.86315 WP_000148855.1.86363 WP_000148855.1.86508 WP_000148855.1.86531 WP_000148855.1.86606 WP_000148855.1.86664 WP_000148855.1.86704 WP_000148855.1.86736 WP_000148855.1.86745 WP_000148855.1.86793 WP_000148855.1.86795 WP_000148855.1.86881 WP_000148855.1.8690 WP_000148855.1.86910 WP_000148855.1.86968 WP_000148855.1.8699 WP_000148855.1.86999 WP_000148855.1.87088 WP_000148855.1.87096 WP_000148855.1.87097 WP_000148855.1.87100 WP_000148855.1.87110 WP_000148855.1.87133 WP_000148855.1.87137 WP_000148855.1.87168 WP_000148855.1.87190 WP_000148855.1.87221 WP_000148855.1.87272 WP_000148855.1.87296 WP_000148855.1.87363 WP_000148855.1.87372 WP_000148855.1.87388 WP_000148855.1.87486 WP_000148855.1.87497 WP_000148855.1.87511 WP_000148855.1.87541 WP_000148855.1.8757 WP_000148855.1.87579 WP_000148855.1.87595 WP_000148855.1.87601 WP_000148855.1.8764 WP_000148855.1.87647 WP_000148855.1.87703 WP_000148855.1.87734 WP_000148855.1.87735 WP_000148855.1.87745 WP_000148855.1.87782 WP_000148855.1.87841 WP_000148855.1.87843 WP_000148855.1.87854 WP_000148855.1.87865 WP_000148855.1.87937 WP_000148855.1.87967 WP_000148855.1.87985 WP_000148855.1.88101 WP_000148855.1.88169 WP_000148855.1.88240 WP_000148855.1.88309 WP_000148855.1.88375 WP_000148855.1.88418 WP_000148855.1.88430 WP_000148855.1.88440 WP_000148855.1.88449 WP_000148855.1.88455 WP_000148855.1.8847 WP_000148855.1.88473 WP_000148855.1.88478 WP_000148855.1.88490 WP_000148855.1.88536 WP_000148855.1.88560 WP_000148855.1.88563 WP_000148855.1.88585 WP_000148855.1.8859 WP_000148855.1.88600 WP_000148855.1.88614 WP_000148855.1.88738 WP_000148855.1.88753 WP_000148855.1.88761 WP_000148855.1.88771 WP_000148855.1.88781 WP_000148855.1.88805 WP_000148855.1.88843 WP_000148855.1.88878 WP_000148855.1.88954 WP_000148855.1.88959 WP_000148855.1.88962 WP_000148855.1.88987 WP_000148855.1.89012 WP_000148855.1.89024 WP_000148855.1.89036 WP_000148855.1.8904 WP_000148855.1.89070 WP_000148855.1.89164 WP_000148855.1.8918 WP_000148855.1.89184 WP_000148855.1.89235 WP_000148855.1.89290 WP_000148855.1.89348 WP_000148855.1.89350 WP_000148855.1.89390 WP_000148855.1.89404 WP_000148855.1.89433 WP_000148855.1.89439 WP_000148855.1.89594 WP_000148855.1.89738 WP_000148855.1.89779 WP_000148855.1.89794 WP_000148855.1.898 WP_000148855.1.89863 WP_000148855.1.89874 WP_000148855.1.8990 WP_000148855.1.89908 WP_000148855.1.89933 WP_000148855.1.89949 WP_000148855.1.89950 WP_000148855.1.90069 WP_000148855.1.90112 WP_000148855.1.90173 WP_000148855.1.90174 WP_000148855.1.90232 WP_000148855.1.90239 WP_000148855.1.90246 WP_000148855.1.90250 WP_000148855.1.90269 WP_000148855.1.90386 WP_000148855.1.90432 WP_000148855.1.90447 WP_000148855.1.90454 WP_000148855.1.90475 WP_000148855.1.90488 WP_000148855.1.90506 WP_000148855.1.90514 WP_000148855.1.90517 WP_000148855.1.90533 WP_000148855.1.9055 WP_000148855.1.90556 WP_000148855.1.90698 WP_000148855.1.9071 WP_000148855.1.90717 WP_000148855.1.9076 WP_000148855.1.90923 WP_000148855.1.90994 WP_000148855.1.91005 WP_000148855.1.91019 WP_000148855.1.91150 WP_000148855.1.91184 WP_000148855.1.9122 WP_000148855.1.91280 WP_000148855.1.91365 WP_000148855.1.91371 WP_000148855.1.91447 WP_000148855.1.91486 WP_000148855.1.91525 WP_000148855.1.91530 WP_000148855.1.9155 WP_000148855.1.91586 WP_000148855.1.91611 WP_000148855.1.91629 WP_000148855.1.91634 WP_000148855.1.91670 WP_000148855.1.917 WP_000148855.1.91704 WP_000148855.1.91745 WP_000148855.1.91848 WP_000148855.1.91918 WP_000148855.1.92125 WP_000148855.1.92186 WP_000148855.1.92212 WP_000148855.1.92228 WP_000148855.1.92244 WP_000148855.1.92249 WP_000148855.1.92259 WP_000148855.1.92303 WP_000148855.1.92391 WP_000148855.1.92405 WP_000148855.1.92425 WP_000148855.1.9247 WP_000148855.1.92479 WP_000148855.1.92512 WP_000148855.1.92544 WP_000148855.1.92667 WP_000148855.1.92674 WP_000148855.1.92718 WP_000148855.1.92765 WP_000148855.1.92795 WP_000148855.1.92848 WP_000148855.1.92849 WP_000148855.1.9286 WP_000148855.1.92897 WP_000148855.1.92918 WP_000148855.1.92937 WP_000148855.1.9296 WP_000148855.1.92960 WP_000148855.1.9298 WP_000148855.1.92997 WP_000148855.1.93010 WP_000148855.1.93047 WP_000148855.1.93068 WP_000148855.1.93071 WP_000148855.1.93141 WP_000148855.1.93147 WP_000148855.1.93186 WP_000148855.1.93197 WP_000148855.1.93207 WP_000148855.1.93237 WP_000148855.1.93243 WP_000148855.1.93254 WP_000148855.1.93260 WP_000148855.1.93354 WP_000148855.1.93378 WP_000148855.1.93435 WP_000148855.1.93471 WP_000148855.1.93492 WP_000148855.1.93579 WP_000148855.1.93613 WP_000148855.1.93690 WP_000148855.1.93708 WP_000148855.1.93736 WP_000148855.1.93758 WP_000148855.1.93762 WP_000148855.1.93775 WP_000148855.1.93890 WP_000148855.1.9392 WP_000148855.1.94 WP_000148855.1.94053 WP_000148855.1.9408 WP_000148855.1.94080 WP_000148855.1.94122 WP_000148855.1.94123 WP_000148855.1.94130 WP_000148855.1.94209 WP_000148855.1.94242 WP_000148855.1.94245 WP_000148855.1.94268 WP_000148855.1.94287 WP_000148855.1.9430 WP_000148855.1.94319 WP_000148855.1.94320 WP_000148855.1.94325 WP_000148855.1.94337 WP_000148855.1.94341 WP_000148855.1.94484 WP_000148855.1.94536 WP_000148855.1.9455 WP_000148855.1.94684 WP_000148855.1.947 WP_000148855.1.94825 WP_000148855.1.94969 WP_000148855.1.94992 WP_000148855.1.95023 WP_000148855.1.95029 WP_000148855.1.95033 WP_000148855.1.95154 WP_000148855.1.95156 WP_000148855.1.95193 WP_000148855.1.95263 WP_000148855.1.95294 WP_000148855.1.95307 WP_000148855.1.95386 WP_000148855.1.95415 WP_000148855.1.9544 WP_000148855.1.95494 WP_000148855.1.95495 WP_000148855.1.95505 WP_000148855.1.95512 WP_000148855.1.95519 WP_000148855.1.95522 WP_000148855.1.95560 WP_000148855.1.9557 WP_000148855.1.95683 WP_000148855.1.95780 WP_000148855.1.95804 WP_000148855.1.95832 WP_000148855.1.95962 WP_000148855.1.96160 WP_000148855.1.96163 WP_000148855.1.96200 WP_000148855.1.96218 WP_000148855.1.96261 WP_000148855.1.96271 WP_000148855.1.96280 WP_000148855.1.96305 WP_000148855.1.96368 WP_000148855.1.96412 WP_000148855.1.96468 WP_000148855.1.96548 WP_000148855.1.96568 WP_000148855.1.96577 WP_000148855.1.96613 WP_000148855.1.96628 WP_000148855.1.96646 WP_000148855.1.96663 WP_000148855.1.96727 WP_000148855.1.96770 WP_000148855.1.96804 WP_000148855.1.96866 WP_000148855.1.96882 WP_000148855.1.96892 WP_000148855.1.96895 WP_000148855.1.96918 WP_000148855.1.96928 WP_000148855.1.9695 WP_000148855.1.96970 WP_000148855.1.96976 WP_000148855.1.97001 WP_000148855.1.97007 WP_000148855.1.97019 WP_000148855.1.97072 WP_000148855.1.97117 WP_000148855.1.97138 WP_000148855.1.97139 WP_000148855.1.97191 WP_000148855.1.97234 WP_000148855.1.97267 WP_000148855.1.97411 WP_000148855.1.97444 WP_000148855.1.97466 WP_000148855.1.97536 WP_000148855.1.97574 WP_000148855.1.97590 WP_000148855.1.97627 WP_000148855.1.97731 WP_000148855.1.97739 WP_000148855.1.97763 WP_000148855.1.97786 WP_000148855.1.97827 WP_000148855.1.97835 WP_000148855.1.9789 WP_000148855.1.97899 WP_000148855.1.98011 WP_000148855.1.98033 WP_000148855.1.98051 WP_000148855.1.98131 WP_000148855.1.98191 WP_000148855.1.98242 WP_000148855.1.98307 WP_000148855.1.98322 WP_000148855.1.98361 WP_000148855.1.98379 WP_000148855.1.98411 WP_000148855.1.98415 WP_000148855.1.98419 WP_000148855.1.98456 WP_000148855.1.98497 WP_000148855.1.98510 WP_000148855.1.98552 WP_000148855.1.986 WP_000148855.1.98655 WP_000148855.1.98706 WP_000148855.1.98767 WP_000148855.1.98837 WP_000148855.1.98858 WP_000148855.1.98874 WP_000148855.1.98967 WP_000148855.1.99009 WP_000148855.1.99025 WP_000148855.1.9903 WP_000148855.1.99155 WP_000148855.1.99171 WP_000148855.1.99183 WP_000148855.1.99237 WP_000148855.1.99249 WP_000148855.1.99280 WP_000148855.1.99311 WP_000148855.1.99359 WP_000148855.1.9936 WP_000148855.1.99405 WP_000148855.1.99430 WP_000148855.1.99492 WP_000148855.1.99494 WP_000148855.1.99519 WP_000148855.1.99524 WP_000148855.1.99536 WP_000148855.1.99538 WP_000148855.1.99564 WP_000148855.1.99569 WP_000148855.1.9960 WP_000148855.1.99631 WP_000148855.1.99638 WP_000148855.1.99686 WP_000148855.1.99700 WP_000148855.1.99714 WP_000148855.1.99802 WP_000148855.1.99850 WP_000148855.1.99860 WP_000148855.1.99862 WP_000148855.1.9987 WP_000148855.1.99888 WP_000148855.1.99901 WP_000148855.1.99926 WP_000148855.1.99934 WP_000148855.1.99956 WP_000148855.1.99979 WP_000148855.1.99985 gi|87161297|ref|YP_493565.1| APC7856 IDP00736 gi|151221045|ref|YP_001331867.1| gi|532358989|ref|YP_008448818.1| gi|479328876|ref|YP_007867935.1| gi|21282573|ref|NP_645661.1| gi|384868170|ref|YP_005748366.1| 196620.MW0844 282458.SAR0924 282459.SAS0832 426430.NWMN_0833 451515.SAUSA300_0865 93062.SACOL0966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]