SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88607442|ref|YP_505251.1| from Anaplasma phagocytophilum HZ

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88607442|ref|YP_505251.1|
Domain Number 1 Region: 529-1029
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-131
Family ALDH-like 0.000000455
Further Details:      
 
Domain Number 2 Region: 180-521
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.06e-100
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000276
Further Details:      
 
Domain Number 3 Region: 10-178
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 5.49e-59
Family N-terminal domain of bifunctional PutA protein 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88607442|ref|YP_505251.1|
Sequence length 1045
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Anaplasma phagocytophilum str. HZ]
Sequence
MMISSLQVPDELRKRMQGLYNTDEKSYIRYLTEKAEVSQDAKVRIYNLAKQIIEKVRFGK
GSTLIDAFMQEYGLSSEEGVALMCLAESLLRIPDECTIDEMIRDKIAGTTWKKHIGSSSS
IFVNASTLALCVGARVLREVDDSRWYSVLSNLLKNMGEPIIRKAALQAMCILGKHFVMGR
DIEDAVARSNDSKQLCSFDILGESARTREDADRYFAAYMHAIEVIGADAGCGDDISSRHG
ISVKLSALHPRYDFAQIDYVLDDISSKLLEICAAAKKHNIGVLIDAEEARRLEASLIVLE
KVFLDKSLDGWEGLGLAVQAYQKRALGVLDIVEDIAIRANRKMVVRLVKGAYWDYEIKNA
QELGLDGYPVFTRRAYTDTSYFACVQRILSKPNTFYPCFATHNAYTLASVLESADKDHPG
FEFQRLHAMGQGLYSYVTGEVAPSVKCRVYAPVGSYQDLLPYLIRRLLENGTNSSFVNKI
NDVDVLAEQLLVDPLEKAKSFEYCPHPSIPLPIDMFGKDRVNSIGLNTSDSLAMSVLNEE
VQTFTNVTRKATPIINGEDVEGAAPIEFFSPGDFSCKVGEVSYATPEQVKEAFAVAHAAY
AEWSALSVEERATILESAADLLEKERGKFVALLMLEGGKVISDVMAEIREAVDFLRYYAM
IARKDIAGTIKLPGPSGEENYIYFESRGVFVCISPWNFPLAIFLGPIAAALVTGNTVIAK
PSEQTSLIAYEAVKLFFRAGLPGSVLQFLPGEGAALGEVLINNGHVAGVAFTGSTDTANI
INRTLAKRNRDIVPIIAETGGINAMIVDSSAVLEQVCDDVITSAFRSAGQRCSALRVLLL
QEEIADRQIEIICGALKELRLGNPMLLSSDVGPVIDQQSYDMLCEYVKGMEEKGAKLLCK
LDIGSLAEVGHYFPPHIFEVGSVSEVAKEVFGPILHIVRYKKSDLVSILEEINKTGYGLT
FSVQSRIQSNIDLIVDKIRTGNVYVNRNQIGAVVGVQPFGGSGLSGTGPKAGGPFYLHRF
VTEKTVTVNTTALGGNVALACLEEE
Download sequence
Identical sequences Q2GK50
gi|88607442|ref|YP_505251.1| gi|526461935|ref|YP_008332770.1| 212042.APH_0669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]