SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G01150.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G01150.1
Domain Number 1 Region: 233-301
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000647
Family DNA-binding domain of telomeric protein 0.01
Further Details:      
 
Domain Number 2 Region: 63-131
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000552
Family PHD domain 0.023
Further Details:      
 
Weak hits

Sequence:  AT1G01150.1
Domain Number - Region: 184-236
Classification Level Classification E-value
Superfamily XseB-like 0.0262
Family XseB-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G01150.1
Sequence length 345
Sequence
MVSDLPLDEDDIALLKSPYIGEIVEEIGFVREKRIAHCIVQCDDGGDEDVNSAPNIFTYD
NVPLKKRHYLGTSDTFRSFEPLNEHACIVCDIADDGVVPCSGNECPLAVHRKCVELDCED
PATFYCPYCWFKEQATRSTALRTRGVAAAKTLVQYGCSELRSGDIVMTRENSQLENGSDN
SLPMQLHENLHQLQELVKHLKARNSQLDESTDQFIDMEKSCGEAYAVVNDQPKRVLWTVN
EEKMLREGVEKFSDTINKNMPWKKILEMGKGIFHTTRNSSDLKDKWRNMNYLDLVEVEID
IIIVVAEIGDQNGEGKKRRSDEEDESNRNHPKIRICGMVFVKPIT
Download sequence
Identical sequences F4HQJ2
NP_171623.1.80155 AT1G01150.1 AT1G01150.1 3702.AT1G01150.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]