SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G03060.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G03060.1
Domain Number 1 Region: 2957-3244
Classification Level Classification E-value
Superfamily BEACH domain 4.58e-121
Family BEACH domain 0.0000000278
Further Details:      
 
Domain Number 2 Region: 3298-3499,3530-3581
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.67e-30
Family WD40-repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 2763-2806,2867-2930
Classification Level Classification E-value
Superfamily PH domain-like 4.55e-17
Family PreBEACH PH-like domain 0.046
Further Details:      
 
Domain Number 4 Region: 693-890,914-989
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000624
Family HspBP1 domain 0.084
Further Details:      
 
Domain Number 5 Region: 1124-1237
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000018
Family Laminin G-like module 0.075
Further Details:      
 
Domain Number 6 Region: 237-359,480-630
Classification Level Classification E-value
Superfamily ARM repeat 0.00000182
Family HspBP1 domain 0.082
Further Details:      
 
Weak hits

Sequence:  AT1G03060.1
Domain Number - Region: 1398-1517,1589-1785
Classification Level Classification E-value
Superfamily ARM repeat 0.0023
Family Armadillo repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G03060.1
Sequence length 3601
Sequence
MKWATLLKDIKEKVGLAQSSDSDPFPVDLTAPPSSSSSSSSPSFTYPSSSSLHHFNFSPS
SRDNHELELDFKRLWEEFRSSSSEKEKEAALNLTVDIFCRLVKRHANVDQLVTMLVETHI
FSFVIGRAFVTDIEKLKIGSKTRSLNVEKVLRFFSDVTKEGFSPGANLLTAVEVLVSGPI
DKQSLLDSGIFCCLIHVLIALLAYDELSKSKITGDLEVVSAEKDAGYIVLQTRRLEVEGS
VVHIMKALASNPSAAQSLIEDDSLESLFNMVANGSITVFSQYKEGLVPLHNIQLHRHAMQ
ILGLLLVNDNGSTARYIRKHHLIKVLLMAVKEFDPSCGDSAYTMGIVDLLLECVELSYRP
EAGGVRLREDIRNAHGYHFLVQFALVLSSLPKNPIFVSSNHDSGSDDPEVFHDGENTNST
ENADFSSQNFAPSLSRLLDVLVTLAQTGPAEPSVGRASRSSQTKPTGHSRSRTSSVDSIY
DETWEQGSGKVKDLEAVQMLQDIFLKAENKDLQAEVLNRMFKIFSSHVENYRLCQELRTV
PLLVLNMAGFPSSLQDIILKILEYAVTVVNCVPEQELLSLCCLLQQPITSQLKHTILSFF
VKLISFDQQYKKVLREVGVLEVLQDDLKQHKLLIGPDQYSGVSSHSDRKPSSGSFRKNLD
TKDAIISSPKLMESGSGKLPVFEVDNTITVGWDCLISLLKKAEANQSSFRAANGVAIILP
FLISDAHRSGVLRILSCLITEDTKQVHHDELGAVVDLLKSGMVTGISGHQYKLHDDAKCD
TMGALWRIVGVNGSAQRVFGEATGFSLLLTTLHTFQGKREHMDESDLTVYIKLFKYLFRL
MTAAVCENAVNRMKLHAVITSQTFFELLAESGLLCVELERQVIQLLLELALEVVVPPFLT
SESTALATIPENENTTFVVTTPSGQFNPDKERIYNAGAVRVLIRSLLLFSPKMQLEFLRL
LESLARASPFNQENLTSIGCVELLLEIIYPFLAGSSPFLSYALKIVEILGAYRLSPSELR
MLFRYVLQMRIMNSGHAIVGMMEKLILMEDTALEHLSLAPFVELDMSKTGHASVQVSLGE
RSWPPAAGYSFVCWFQFRNFLTTQGKESEASKAGGSSKTRMTSAQQHEQNIFRMFSVGAV
SNESPFYAELYFQEDGILTLATSNSHSLSFSGLEIEEGRWHHLAVVHSKPNALAGLFQAS
VAYVYLDGKLRHTGKLGYSPSPVGKSLQVTVGTPATCARVSDLTWKTRSCYLFEEVLTSG
CIGFMYILGRGYKGLFQDADLLRFVPNQACGGGSMAILDSLDTDMTSSSNGQKFDGSNRQ
GDSKADGSGIVWDLERLGNLAFQLPGKKLIFAFDGTCSEFIRASGNFSLLNLVDPLSAAA
SPIGGIPRFGRLVGNVSICRQSVIGDTIRPVGGMTVVLALVEAAESRNMLHMALSLLACA
LHQNPQNVKDMQTIRGYHLLALFLRPKMTLFDMQSLEIFFQIAACEALFSEPKKLESVQS
NITMPPTETIFENSYEDLSLSRFRYDSSSVGSHGDMDDFSVPKDSFSHLSELETDIPVET
SNCIVLSNADMVEHVLLDWTLWVTSPVSIQIALLGFLENLVSMHWYRNHNLTILRRINLV
EHLLVTLQRGDVEVPVLEKLVVLLGCILEDGFLTSELENVVRFVIMTFNPPEVKSRSSLL
RESMGKHVIVRNMLLEMLIDLQVTIKAEDLLELWHKIVSSKLITYFLDEAVHPTSMRWIM
TLLGVCLASSPNFSLKFRTSGGYQGLLRVLQNFYDSPDIYYILFCLIFGKPVYPRLPEVR
MLDFHALVPNDGSYVELKFIELLDSVVAMAKSTYDRLIMQSMLAHQSGNLSQVSASLVAE
LIEGAEMTGELQGEALMHKTYAARLMGGEASAPAAATSVLRFMVDLAKMCPQFSTACRRA
EFVENCADLYFSCVRAAYAVKMAKQLSVKAEEKHINDADDSGSQGSLPHDQDQSTKTSIS
VGSFPQGQVSLGSEDMSLPANYVVNDKMENILPPPTQDTSKSLQGVEDVKKQDDHHVGPS
ASSERDFQDFTGNPVQVQATDSQSSASFPMIESPLLSEKSSLKVSFTPSPSPVVALASWL
GSNYNESKSSTLGSPSLESYVSVNEVDASSERKSGSQGSSAANAFFTVSPKLLLETDETG
YGGGPCSAGASAVLDFMAEALADLVTEQIKAVPVLESILEMVPFYVDPESVLVFQGLCLS
RVMNYLERRLLRDDEEDEKKLDKAKWSVNLDAFCWMIVDRVYMGAFSQPAGVLRALEFLL
SMLQLANKDGRVEEVTPSGKGLLSLGRATRQLDAYVHSILKNTNRMVLYCFLPSFLITIG
EEDLLSQLGLLVESKKRPSPNPATDESGIDISTVLQLLVANRRIIFCPSNLDTDLNCCLC
VNLISLLLDQRKSVQNMSLDIVKYLLVHRRSALEDLLVTKPNQGQNFDVLHGGFDKLLTG
NLPEFFKWLESSDKIINKVLEQCAAIMWVQYIAGSAKFPGVRIKGMEGRRKREMGRKSRD
MSKLDLKHWDQLNERRYALEVLRDAMSTELRVVRQNKYGWILHAESEWQTHLQQLVHERG
IFPMRKSKGTEDPEWQLCPIEGPYRMRKKLERCKLKIDSIQNVLDGKLELGEIELPKVKN
EDGPVISDTDSEPPFLLSELYDESFLKESDDFKDVASARNGWNDDRASSTNEASLHSALD
FGGKSSIASVPITDTTHVKSETGSPRHSSSAKMDETNGREEKSEKELNDDGEYLIRPYLE
HLEKIRFRYNCERVVDLDKHDGIFLIGEFCLYVIENFYIDEDGCICEKECEDELSVIDQA
LGVKKDVSGSSDFHSKSSTSWTTTVKTGAVGGRAWAYGGGAWGKEKMCMTGNLPHPWRMW
KLNNVHEILKRDYQLRPVAIEIFSMDGCNDLLVFHKKEREEVFKNLVAMNLPRNSMLDTT
ISGSAKQESNEGGRLFKLMAKSFSKRWQNGEISNFQYLMHLNTLAGRGYSDLTQYPVFPW
VLADYDSESLDFSDPKTFRKLHKPMGCQTPEGEEEFRKRYESWDDPEVPKFHYGSHYSSA
GIVLFYLIRLPPFSSENQKLQGGQFDHADRLFNSIKDTWLSAAGKGNTSDVKELIPEFFY
MPEFLENRFSLDLGEKQSGEKVGDVFLPPWARGSVREFILKHREALESDYVSENLHHWID
LIFGYKQRGKAAEEAVNVFYHYTYEGNVDIDAVTDPAMKASILAQINHFGQTPKQLFPKA
HVKRRTDRKIPLHPLKHSMHLVPHEIRKCSSSISQIITFHDKVLVAGANCFLKPRGYTKY
ITWGFPDRSLRFMSYDQDKLLSTHENLHESNQIQCAGVSHDGRIVVTGAEDGLVCVWRVS
KDGPRGSRRLRLEKALCAHTAKVTCLRVSQPYMMIASGSDDCTVIIWDLSSLSFVRQLPD
FPVPISAIYINDLTGEIVTAAGTVLAVWSINGDCLAVANTSQLPSDSVLSVTGSTSSDWL
ETSWYVTGHQSGAVKVWRMIHCTDPVSAESKTSSSNRTGGLNLGDQVPEYKLILHKVLKF
HKQPVTALHLTSDLKQLLSGDSAGQLLSWTVPDETLRASMKQASLKQASLKQASLKQASS
V
Download sequence
Identical sequences F4HZB2
NP_171805.1.80155 AT1G03060.1 AT1G03060.1 3702.AT1G03060.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]