SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G03150.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G03150.1
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.79e-27
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G03150.1
Sequence length 174
Sequence
MTTIRRFSCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRVMGYIMGK
VEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIK
MYEKLGYIIYRRVLRYYSGEEDGLDMRKALSRDVEKKSVIPLKRPITPDELEYD
Download sequence
Identical sequences A0A087HKM3 A0A178WDM9 D7KCB9 Q8LGI8 R0IDH7
AT1G03150.1 NP_563677.1.80155 XP_002889439.1.15461 XP_006303362.1.15642 XP_010474913.1.75697 XP_010474924.1.75697 GO.132 Carubv10010452m|PACid:20891198 AT1G03150.1 jgi|Araly1|887467|scaffold_100261.1 3702.AT1G03150.1-P 59689.scaffold_100261.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]